About Products Protein Database Contact

nuoA1

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Geobacter uraniireducens (strain Rf4)
Length
145 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
16.12 kDa
Sequence
MSMSTPQKAILPPFNADILPLGLYVAATVLLIGILLLAAWWLGDKKRSAAKEIAYESGVIPTGTARLAYPVPFYLVAIFFIVFDVEAVFIFTWAVAWDELGFPGLIHITAFIIVLLLGLVWLWLKGGLEWGPSKQVRRSKFEVRS

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Length
138 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
15.461 kDa
Sequence
MQQTTVANHSLFPTLPPEFLPLALYTVAATVLIGVLLLAAWWLGAKTTNRNKELPYESGVIPTGSARLAYPVPFYLIAIFFIVFDVEAAFIFAWATAWRELGLAGLIHITFFIVILLLGLVWLWMKGGLDWGPSRERR

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Pseudomonas aeruginosa (strain PA7)
Length
137 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.994 kDa
Sequence
MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSALLGSKAFGRSKNEPFESGIVPTGGARLRLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGALDWAPESRRKRQAKLKQ

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Pseudomonas aeruginosa (strain UCBPP-PA14)
Length
137 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
15.01 kDa
Sequence
MPNPAELAAHHWGFAAFLLGVVGLLAFMLGVSSLLGSKAFGRSKNEPFESGIVPTGGARLRLSAKFYLVAMLFVIFDVEALFLFAWSVSVRESGWAGLIEATIFIAILLAGLVYLWRIGALDWAPESRRKRQAKLKQ

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Length
134 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.667 kDa
Sequence
MPVTAQQVELIPLAIYTLFAVGLIGILLLAARYLGSGKETSEKHIPFESGMVPTGNARHASQVPFYLIAIFFIVFDVEGAFILAWATSWDLLGIPGLVHITLFITVLLLGLVWLWMKGGLDWGPSAMRARGKRS

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
132 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.713 kDa
Sequence
MYASFAPATWALLAYLFGALALCLLMLGLGRVLGGRSHGRAKNLPFESGVDSTGSSRLRFSVKYALVAMLFVIFGIEMPFLYLWAVSLRENGWAGFVEATLFVSLLLVGLFYLHRVGALDWSPERRRKKPHD

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Length
121 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.897 kDa
Sequence
MLESYFPIFVVISIAIILAVVLLSIGKIIGPKRNNPEKLTPYESGMDPVGSTRTRVTVRFYLVAMIFIVFDIEVIFMYPWAVSFRELSGFYGLIPMVTFVLILLAGYYYILKKKALDWDEE

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Rhizobium meliloti (strain 1021)
Length
121 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.804 kDa
Sequence
MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFDVRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEWN

Gene
nuoA1
Protein
NADH-quinone oxidoreductase subunit A 1
Organism
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Length
118 amino acids
Function
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.254 kDa
Sequence
MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECGCEPVGSARERFSVKFYIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFVGYIYVWKKGALEWE