nqo7

NADH-quinone oxidoreductase subunit 7

121 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.633 kDa

MEYLLQEYLPILVFLGMASALAIVLILAAAVIAVRNPDPEKVSAYECGFNAFDDARMKFDVRFYLVSILFIIFDLEVAFLFPWAVSFASLSDVAFWGLMVFLAVLTVGFAYEWKKGALEWA

nqo7

NADH-quinone oxidoreductase subunit 7

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient required for the synthesis of ATP.

Belongs to the complex I subunit 3 family.

13.145 kDa

MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH