nqo14

NADH-quinone oxidoreductase subunit 14

499 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 2 family.

52.535 kDa

MTSLDFSTILPEVVLAGYALAALMAGAYLGKDRLARTLLWVTVAAFLVVAAMVGLGNHVDGAAFHGMFIDDGFSRFAKVVTLVAAAGVLAMSADYMQRRNMLRFEFPIIVALAVLGMMFMVSAGDLLTLYMGLELQSLALYVVAAMRRDSVRSSEAGLKYFVLGSLSSGLLLYGASLVYGFAGTTGFEGIISTIEAGHLSLGVLFGLVFMLVGLSFKVSAVPFHMWTPDVYEGSPTPVTAFFATAPKVAAMALIARLVFDAFGHVIGDWSQIVAALAVMSMFLGSIAGIGQTNIKRLMAYSSIAHMGFALVGLAAGTAIGVQNMLLYMTIYAVMNIGTFAFILSMERDGVPVTDLAALNRFAWTDPVKALAMLVLMFSLAGVPPTLGFFAKFGVLTAAVDAGMGWLAVLGVIASVIGAFYYLRIVYYMYFGGESEGMTSRMGAVQYLALMVPALAMLVGAISMFGVDSAAGRAAETLVGPVAAIEQPAEAAQAEPVQGE

nqo14

NADH-quinone oxidoreductase subunit 14

427 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient required for the synthesis of ATP.

Belongs to the complex I subunit 2 family.

44.436 kDa

MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSGRFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGSLVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALSVVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDPLLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARAAVVAAGVLLLALGLLPGLVLPALAAGG