nqo10

NADH-quinone oxidoreductase chain 10

200 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 6 family.

21.819 kDa

MMTFAFYLFAISACVAGFMVVIGRNPVHSVLWLILAFLSAAGLFVLQGAEFVAMLLVVVYVGAVAVLFLFVVMMLDVDFAELKGELARYLPLALVIGVVLLAQLGIAFSGWTPSDQAESLRAAPVDAAVENTLGLGLVLYDRYVLMFQLAGLVLLVAMIGAIVLTMRHRKDVKRQNVLEQMWRDPAKTMELKDVKPGQGL

nqo10

NADH-quinone oxidoreductase subunit 10

176 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient required for the synthesis of ATP.

Belongs to the complex I subunit 6 family.

18.551 kDa

MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPGKASRAKEAEKREEVAR