Protein
Nascent polypeptide-associated complex subunit beta
Organism
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Function
Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Npc-2/egd1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.
Similarity
Belongs to the NAC-beta family.
Sequence
MSDVQERLKKLGASARIGIGKGTPRRKVKRAPARSAGDDKKLQATLKKVNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQKNEKDAEEDDIPDLVAGENFESKVE