nkiras1

NF-kappa-B inhibitor-interacting Ras-like protein 1

192 amino acids

Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation.

Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.

21.546 kDa

MGKGCKVVVCGMASVGKTAILEQLLYGSHTVGAETSDTQEDIYVASVETDRGVREQLRLYDTRGLREGLDLPKHFFSVADGFVLVYSVDCLESFKKVEVLKKEIDRSRDKKEVMVMVLGNKCELRERRQVDQDTAQQWARGEKVKLWEVTVTDRSTLIEPFTSLTSRLTQPQSKSAFPLPGRKSKGTPSNDI

NKIRAS1

NF-kappa-B inhibitor-interacting Ras-like protein 1

192 amino acids

Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.

21.643 kDa

MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN

NKIRAS1

NF-kappa-B inhibitor-interacting Ras-like protein 1

192 amino acids

Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).

Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.

21.616 kDa

MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSSSEN

Nkiras1

NF-kappa-B inhibitor-interacting Ras-like protein 1

192 amino acids

Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).

Belongs to the small GTPase superfamily. Ras family. KappaB-Ras subfamily.

21.662 kDa

MGKGCKVVICGLLSVGKTAILEQLLYGNHTIGMEDCETLEDVYMASVETDRGVKEQLHLYDTRGLQKGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKLDLSEQRQVDADVAQQWARSEKVKLWEVTVTDRRTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNPEN