nikO

Nickel import ATP-binding protein NikO

254 amino acids

Part of the energy-coupling factor (ECF) transporter complex NikMNQO involved in nickel import. The complex confers nickel uptake upon expression in E.coli; can also transport cobalt with a very low affinity. Presumably responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily.

27.039 kDa

MTPAFELQGVQFAYKGVPALNGLDLTLPLGRRTALLGANGSGKSTLLRLLDGLQFPAAGRISAFGTPLTEAMFTDEAAAIAFRRRVGFVFQNPEVQLFCPSVFDELAFGPLQLHWPKERIRARVARAIAQFGLGPLAGRPPHRLSGGEKKRVALASVLILDPEVLLLDEPTAALDPQATDDIAALLETEFGARNPGRTLIFSSHDLDLVARIADHVVVLEAGKVAAAGPAAEVLARTALLRRARLLPGFDGTAP