new18

Mitochondrial zinc maintenance protein 1, mitochondrial

100 amino acids

Assembly factor required for Rieske Fe-S protein RIP1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane. Modulates the mitochondrial matrix zinc pool (By similarity).

Belongs to the complex I LYR family. MZM1 subfamily.

11.541 kDa

MSAAKQCFRNLWRASNSVFEGDPMILAAARDKIRTGFHNHRCCSPEEAKKEIQNGNAVAEILRRNVVQAEKQSNDTYSLKIRKTTEINTNRQFTEKKFPR