Function
Involved in the degradation of toxic compounds (PubMed:9013822, PubMed:15184158, PubMed:17504490, PubMed:23527133, PubMed:23506073, PubMed:23536188). Can use a variety of substrates, including the nitrate ester explosives glycerol trinitrate (GTN) and pentaerythritol tetranitrate (PETN), chromate and various electrophiles such as quinones (PubMed:15184158, PubMed:23527133, PubMed:23506073). Involved in resistance to hypochlorous acid (HOCl), which is the active component of household bleach and a powerful antimicrobial during the innate immune response (PubMed:23536188). Catalyzes the reduction of N-ethylmaleimide (NEM) to N-ethylsuccinimide (PubMed:9013822, PubMed:23506073). Together with NfsA and NfsB, can use the nitroaromatic explosive 2,4,6-trinitrotoluene (TNT) (PubMed:17504490).
Sequence
MSSEKLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIISEATQISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAPVAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGTFQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEPYTDAFREKVRARFHGPIIGAGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAELNPQRAESFYGGGAEGYTDYPTL