ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

214 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.364 kDa

MILAEGVQKFSLFFLEGAVLVGALGVVLLPNILYSAFLLGGVLMSIAGIYLLLNADFVAAAQVLIYVGAINVLILFAIMLVNKNDGRVAAGTSNSSGVTNNIIGLTCIGLAGFLIDMIVTTPWLPKGVAVATSLSAKADSTAAQTQLKGSISIIGLHIFSDFLLPFEVISLLLLVTLVGAIVIARRERLSDLEISKISLLNLPDPSNGKTPSLK

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, organellar chromatophore

205 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.325 kDa

MTISNATQLICFFALSATLILGALGVVLLPNIVYSAFLLGSVFLSVAGLYLLLNASFVAAAQVLIYVGAVNVLILFAIMLVNREEELKVIPGLAIRRFFSGVVCMGLLVILERIATTTHWAQVGPIPLGEEATIRIGEHLFSDYLLPFELASILLLIAMIGAIVLARKDLVDLKPIIEQRIDPKEIKLPSSSMFRKKSKKLTDMG

ndhG

NAD(P)H-quinone oxidoreductase chain 6

202 amino acids

NDH-1 shuttles electrons from NAD(P)H, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

21.406 kDa

MNLAEGVQVVSFGILATMLIGTALGVVLATSIVYSAFLLGGVFISIAGMYLLLNGDFVAAAQVLVYVGAVNVLILFAIMLVNKRQDFTPYPSAGIRKVLTAIVSVGLFALLSTMVLATPWAYSTTPKVGDGSIIVIGEHFFSDFLLPFELASVLLLMAMVGAIILARREYLPEVTPSGLPQTVLTLPERPRELVGAGSETQE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

200 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.201 kDa

MNIINLPELNYEVFFVFIELGLIFGSLGVVFLTNIVYSAFLLGLVFVCISFLYLLLDADFVATAQILIYVGAVNILIVFAVMLINKPQSLQFLPSWTVGDTITLILCTSLFFLLISMILSISWSNIFSIAQSNKIGEQVLKSSVQGIGSSLLIDFLLPFELLSIVLLVALIGAITIARREKKVKLQKNRTLQVTKDSFIL

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

200 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

22.205 kDa

MNIIELFGPLQEIIFFILEIGVILGSLGVVLLSNIVYSAFFLGLVFFCISLLYFALNADFVAAAQILIYVGAVNVLIVFAVMLINKPESLKIFPVWTVGDKITLAICLTSFFLLVNIILNTSWSNITVITESKGFLESNFTQNVQRIGSLLLTQYLLPFELLSIVLLVALIGAIVIARRENLIETNKKKVLQIKKSPTTF

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

199 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

21.976 kDa

MSVIDLPEFFYKAILLLIESGVILGSLGVVLFTNIVYSAFLLGWVPVCISFLYILLNADFVAAVQILIYVGTINVLIVFAVMLINKPQYFRFLKYWTVGDGTALALCTSPFLSIIAAILSTPWSKISLIVLSNKIVEEPLTDNVQRIGFHSLTDSPLPFELLSIILLVAPVGAITMARREEAVEAEESEALKTKDDFPF

ndhG

NAD(P)H-quinone oxidoreductase chain 6

199 amino acids

NDH-1 shuttles electrons from NAD(P)H, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

21.299 kDa

MNLAEGVQIVSFAILAAMMIGSAIGVVLLENVVYSAFLLGGVFISIAGLYLLLNADFVAAAQVLIYVGAVNVLILFAIMLVNKREAFQPIAKSWIRRAATALVCAGIFALLSAMVLTTPWAISTAVPIESSIITIGLHFFTDFLLPFELASILLLMALVGAIVLARREFLPDEDEADTALTLPERPRELVPAGQNNPEN

ndhG

NAD(P)H-quinone oxidoreductase chain 6

198 amino acids

NDH-1 shuttles electrons from NAD(P)H, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 6 family.

21.523 kDa

MNLAEGVQYISFLILAFLVIGAALGVVLLSNIVYSAFLLGGVFLSISGIYILLNADFVAAAQVLVYVGAVSVLILFAIMLVNKREDFSKIPGRWLRNVSTALVCTGIFALLSTMVLITPWQINETGPFVENTLVTIGKHFFSDYLLPFELASVLLLMAMVGAIILARRDLIPELSEENKTATALTLPERPRELTSASK

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

197 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

21.525 kDa

MILPEPIHKVILVIIELGILLGSLGVVLLTNIVYSALLLGLVFICISLLYLVLNADFVAAAQVLIYVGAVNVLTVFAVMLIDKPKNITLFSFSNVGDNITLGVCTSLFILLTIMIPDASWSEIYMTKQSTKFVEQGLTTDVQLIGSQLLTKFLLPFELLSILLLVALIGAITIARQERIVEIDDNKASESKEDLSLF

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

197 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

20.866 kDa

MNISELIHDFVLALVELGILLGSLGAVLLVNTVNSAFSLGLVFTCISLLYFVLNADFVAAAQLLVYVGAINVLTVFAVMITDEPAGSETTARGIGYIITAGTCTILFSILSFVIHNTKWSDLSLIPQSGISTSGTLGSNVQQLGYKLLGEFVIPFELLSILLLAALVGAINLARNEDAFIVNKKSAASAPYKNSTFF

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

191 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

21.607 kDa

MKLPESFYETIFLFLESGLILGSLGVILLTNIVYSALFLGFVFVCISLLYLLLNADFVAAAQILIYVGAVNVLIIFAVMLINKKQYSNFFVYWTIGDGITLTLCTSIFLLLNNFISNTSWSKIFLMTKPNLVVKDIILINTVRHIGSELLTEFLLPFELMSIILLVALIGAITLARREKKIELEKNDFFNF

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

189 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

20.707 kDa

MSFSEQIQNLSLLLLEIGTIIGALGVVLLPNILYSGFLLGGVLICIAGIYLLLNAEFIAAAQVLIYVGAINVIILFAIMLVNKIENLNPSNNQMMRNGLSSFICFSFFILLSNMIFDTQWIDTVGVSTKYSISIIGNHIFSDFLLPFEIVSVLLLVTLVGAVFIARKEDASEIEISKISFLNLPDPSKK

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

188 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

20.717 kDa

MNLPESIQKGILLIIELGILLGSMGVILLNDIVQSAFSLGLTFISISLLYLVLNADFVAAAQVLIYVGAINVLIVFSVMLIQKPHKNEDLSTSRNTGNNITLIVCTSLFLFLVSIILDTSWSQIYSIKKSTKIFEPILKSNVQLIGSQLLTEFLLPFELLSVLLLVALVGAITMSRQSRMFEMPDDEI

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

181 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.83 kDa

MNMVSLPETINSPILYFLDVGILLGGLGVVFFGKIIYSALFLGVVFVCVALLYLLLNADFLAAAQILIYVGAINVLIVFAIMLINKPETKINKKKITFGDILSGFSVFGLFSFLIIMILNTTWLQPTLVSQEVKNSFQSIDIIGIHLLTDLLLPFELLSILLLVALVGAITIARKEISPKI

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

181 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.723 kDa

MIPISESTNTLLFVVLEFAILVGALGVVLLSRVIYSALLLGFVFICVALLYLLLNADFLAAAQVLIYVGAVNVLIVFAIMLVSTPDDVKNKPKTTGEIISAFTFIALFVLLTIMIFTTSWDTHHNLATQDEVLLQPLMSNVQTIGFHLLTDLLFPFELLSLLLLVALVGAITIASKNKITE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

180 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.857 kDa

MNRPESIYDLLLAPLTLSLIFGGIGVVLLTNIIYSALSLGLVLICISFFYIILNADFVAVAQILIYIGAVNILILFAVMLMNNPKYPNYAPPWTVGDSISSIVCTSLFCSLITIILNISWFGISLTQKSDQMLERDLTNNIQRIGAHLSTDFFLPFELISIILLVALIGAITIARREETV

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

180 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.625 kDa

MDLPGPIRDILLVPLELGLILGGLEVVLLTNIIYSALSLGPVLVCISLLYILLNADFVAAAQILIYVGAVNVLIVFAVMLMNNQKYPNFVPLWTVGDGITLVVCTSLFCSLITIILNTSWSEISMTTKSNQILEQDLTNNVQRIGAHLSTDFFLPFELLSIILLVALVGAITIARREEIV

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

179 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

20.041 kDa

MLEQSAQITLFVLDFFIFVGALGVVFFNNIIYSALFLGLTFLSVALLYLLLGSEFLSVAQVIIYVGAINVLIVFAIMLVNKPEFDKKDMIWVPIDLKSFCVNFILFSTIVTMIVTTPWKLLVNNIDVKLNSLNFLSPIAKIGYQFLSTLVLPFELLSLLLLIALIGAVIIARRELIEDT

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

178 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.97 kDa

MDFLNMSYQLIVAYLIQLGIYIGALAVIFFNNIVYAAISLALVLSLIALLYLFFDADFLAVTQILIYVGAINVLILFAIMLISLPKSSTFIFYFTKKSQISAFACISLFVLLVKIILQTPWSTQSSYILLNENNKLDQIGIYLLSNFLLPFELISLLLLIALIGAVSIARYQNTEETE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

178 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.425 kDa

MDLPGPIHDFILVFLGSGLILGGLGVVLFTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAVNVLIIFAVMFMNGSDYSKDFQLNLWTIGDGLTSLVCTSIFFSLITTILDTSWYGIIWTTRANQIIEQDLISNSQQIGIHLSTDFFLPFELVSIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.255 kDa

MDLLGPIHDILLVSLGSGIILGSLGVVLLTNPIYSAFSSGLVLVRISLFHILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYNNFHLWTVGDGISSVVCTSILFSLIATILDTSWYGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFFLPFELISIILLVALVGAIAMARAE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.451 kDa

MDLPGPIHDIFLVFLGSGLILGGLGVVLLTNPVYSAFSLGLVLVCISLFHIPSNSYFVAAAQLLIYVGAINVLIVFAVMFMNGSEYYNYFHLWTVGDGVTSLICTSILFSLIKTILDTSWYGIIWTTRSNQIIEQDLISNVQQIGIHLSTDFYLPFELISIILLVALVGAIAMARQE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.471 kDa

MDLPAPIHDILLVSLGSGLIVGGLGVVLLTNPIYSAFSLGLVLVCISLFYIPSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYYNYFHFWTVGDGFTSLVCTSIFFSLIATIPNTSWYGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVSLVGAIAMARRE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.347 kDa

MDLTGPIHDILVVFLGLVLILGGLGVVLFTNPIYSAFSLGLVLICVSLFYILLNSYFVAAAQLLIYVGAINVLILFAVMFMKGSEYSNDLNLWTVGDGVTSLVCTSILFLLISTISDTSWYGIIWTTKANHIIEQDLISNVQQIGIHLSTDFFLPFELISIILLVALIGAISMARQN

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.369 kDa

MDLPAPIHDILLVSLGSGLIVGGLGVVLLTNPIYSAFSSGLVLVCISLFYIPSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYYNSFHFWTIGDGFTSVVCTSIFFSLIATIPNTSWYGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVSLVGAIAMARRE

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.42 kDa

MDLPGPIHDFLLVFLGLGFIMGGLGVVLLTNPIFSAFSLGLVLVCTSLFYTPSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYSDFHLWTVGDGVTSLVCTSIFVSLITTIPDTSWYGIVWTTRSNQIIEQDLINNSQQIGIHLSTDFFLPFELISIILLVALIGAISMARQY

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.258 kDa

MDLPGPIHDVLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSYFVAAAQLLIYVGAVNVLIIFAVMFMNGSDYSNDFYLWTVGDGVTSLVCTSILFSLITTILDTSWYGIIWNTGSNQIVEQDLTSNVQQIGIHLSTDFYLPFELVSIILLVALIGAITMARQY

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

177 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.258 kDa

MDLPGPIHDVLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSYFVAAAQLLIYVGAVNVLIIFAVMFMNGSDYSNDFYLWTVGDGVTSLVCTSILFSLITTILDTSWYGIIWNTGSNQIVEQDLTSNVQQIGIHLSTDFYLPFELVSIILLVALIGAITMARQY

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.461 kDa

MDLPGPIHEILMLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTSLVCITIVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.203 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILANSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYFTDFNLWTVGDGITSLVCTTLLFSLISTILDTSWYGVIWTTRLNQILEQDLISNSQQIGSHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.214 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTIGNGITSLVCTTILFLLMSTILDTSWYGVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.385 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLDALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.2 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDLNLWTVGNGITSLVCTTILFSLMSTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.409 kDa

MDLPGPIHEILVLFLGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNSWTIGDGFTSLVCITIVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.151 kDa

MDLPGPIHDFLLVFLGSGIILGGLGVVLLTNPIFSAFSLGLVLFCISLFHIPSNSHFVAAAQLLIYVGAINVLIIFAVMFTNGSEYYNDFHVWTVGDGVTSLVCTSIFVSLITTILDTSWYGIIWTTRSNQIIEQDLISNGQQIGIHLSTDFFLPFELVSIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.198 kDa

MDLPGPIHDILLVFLGLGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFHIPSNSYFVAAAQLLIYVGAVNVLIVFAVMFMNGSEYSNDFHLWTVGDGVTSLVCTSILFSLITTIWNTSWYGIIWTTRSNQIIEQDLTSNVQQIGIRLATDFYLPFELISIILLAALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.2 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGNGITSLVCTTILFLLMSTILDTSWYGVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.315 kDa

MDLLGPIHDFLLVFLGSGLILGGLGVVLFPNPIYSAFSLGFVLACISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYRDFNLWTIGDGITSLVCTSIFLSLITTILDTSWYGVIWTTRLNQILEQDLISSSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.33 kDa

MDLPGPIHDILLVFLGSGLILGGLGVVLFTTPIYSAFSLGLVFVCISLFYIPSNSYFVAAAQLLIYVGAVNVLIVFAVMFMNGSEYYKDFHLWTVGDGITSLVCTSILFSLITTILETSWYGIIWTTRSNQIIEQDLTSNVQQMGIHLSTDFYLPFELTSIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.211 kDa

MDLPGPIHDILLVFLGSGLILGGLGVVLLTNPISSAFSLGLVLVCISLFYIPSNSYFVAAAQLLIYVGAINVLIVFAVMFMNGSEYYNDFHLWTIGDGFTSLVCTSILFSLITTIPDTSWYGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.379 kDa

MALPETLHDFLLVFLGSGLILGSLGVVLLTNPIFSAFSLGLVLVCISLFYILSNSHFVAASQLLIYVGAINILIIFAVMFMNSSEYYQDFNLWTVGDGITLIVCTSIFVSLVTTIPDTSWYGIIWTTRPNQIIEQDLISTSQQIGIHLSTDFFLPFELISIILLVALIGTIVVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.268 kDa

MNLPGPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGFVLVCISLFYILLNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTIGDGVTSVVCTGLFISLITTIPDMSWYGIIWTTKSNQILEQDLITNSQQIGVHLSTDFFLPFELVSIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.184 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGNGITSLVCTTILCLLMSTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.249 kDa

MDLPGPIHDFLVVLLGSGLILGSMGVLLFNNSIYSAFSLGLVLVSISLFYILANAQFVAAAQLLIYVGAINVLIIFAVMFMKGSEYSKDFNLWTVGNGVTFLVCTSIFVSLMTTIVDTSWYGIIWTTRSNQILEQDLISNSQQIGIYLSTYFFLPFELISIILLAALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.221 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGVTSMVCTSIFVSLITTIPDTSWYGIIWTTKSNQIVEQDLISNSQQIGIHLSTDFFLPFELISIILLVSLIGAITVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.347 kDa

MDLLGPIHDILVIFLGSVLILGGLGVVLLNNLIYSAFSLGWVLFCISLFYISSNSYFVAAAQLLIYVGAINVLIIFAVMFISGSEYSNDSHLWTVGDGVTSVVCTSIFFSLITTIPDTSWYGIIWTTRSNQIIEQDLISNVQQIGIHLSTNFYLPFELISIILLISLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.365 kDa

MDLPGPIHDFLLVFLGFGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFTLWTVGDGITSLVCTTLLFSLISTILDTSWYRVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.162 kDa

MDLPGPIHDILLVFLGSGLILGGLGVVLFTNPIFSAFSLGLVLVCISLFHILSNSYFVAAAQLLIYVGAVNVLIIFAVMFMNGSEYYNDFYLWTVGDGVTSLVCTSILFSLITTISDTSWYGIIWTTGSNQIIEQDLISNVQQIGIHLSTDFYLPFELISIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.158 kDa

MDLPGPIHDFLLVFLGSGLILGSLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINILILFAVMFMNGSEYYKDLNLWTVGDGITSLVCTSILVSLMTTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.188 kDa

MDLPGPIHDFLLVFFGSGLILGGLGVILFTNPIFSAFSLGLVLVCISLFYIIANSQFVASAQLLIYVGAINVLIIFAVMFINGLEYDKNLRLFTLGDGMTLVICTGIFFLLITTILNTSGYGIIWTTKLNQILEQDLINNSQQIGIHLSTDFFPPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.423 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLRINPIYSAFSLGLVLVCISLFYILTNYHFVATAKLLIYVGAINVLILFVVMFMNSSEYYKDFNPWTIGNGLTSLVCTSILVSLISTILDTSWYGIIWTTRSNQIIEQDLIGNSQQIGIHLATDFFLPFEFISIILLVALIGAIDVTLQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.219 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTIGNGLTSLVCTSILVSLITTILDTSWYGIIWTTRSNQIIEQDLISNSQQIGIHLATDFFLPFEFISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.127 kDa

MDLPGLIHDFLLVFLGLGLILGGLGVVLLANPIYSAFSLGLVFVCISLFYILANSHFVAAAQLLIYVGAINVLIIFAVMFINGSEYSKDFHLWTVGDGVTSVVCTSLFVSLITTIPDTSWYGIIWTTKANQIIEQDLISNSQQIGIHLSTDFFLPFEFISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.143 kDa

MDLPGLIHDFLLVFLGLGLILGGLGVVLLANPIYSAFSLGLVFVCISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFINGSEYSKDFHLWTVGDGVTSVVCTSLFVSLITTIPDTSWYGIIWTTKANQIIEQDLISNSQQIGIHLSTDFFIPFEFISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.509 kDa

MDLPGPIHEILMLFGGFILLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTSLVCITFVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.266 kDa

MDLPGPIHDFLLVFLGSGLILGSIGVVLFPNPIYSAFSLGLVLVCISLFYILSNSYFVAAAQLLIYVGAINVLILFAVMFLNGSEYSNDFPLWTLGDGITSQVCISLFISLISTILDTSWYGIIWTTRSNQIIEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAIVIARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.529 kDa

MDLPGPIHDFLLVFLELGLILGSLGVVFLPNPIYSAFSLGLVLFCISLFYILLNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFYLWTVGDGVTSMVCTSLFISLITTIPDTSWYGIIWTTKSNQIIEKDLISNSQQIGIHLVTDFFLPFELISIILLVALIGAIAIARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.025 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.025 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.025 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.025 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.025 kDa

MDLPGPIHDFLLVFLGSGLIVGGLGVVLLTNPIFSAFSLGLVLVCISLFFSLSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDLTLWTVGDGITSLVCTSIFISLITTILDTSWYGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.228 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGNGITSLVCTTILFLLMSTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.349 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPTFSAFSLGLVLVCISLFYILLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNFWTIGDGFTSLVCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.349 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPTFSAFSLGLVLVCISLFYILLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNFWTIGDGFTSLVCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.349 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPTFSAFSLGLVLVCISLFYILLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNFWTIGDGFTSLVCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.349 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPTFSAFSLGLVLVCISLFYILLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNFWTIGDGFTSLVCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.203 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFHLWTIGDGVTSMVCTSIFVSLITTIPDTSWYGIIWTTKSNQIIEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.393 kDa

MDLPGPIHDFLLVFLGSGIILGGLGVVLLTNPIYSAFSLGFVFICISLFYILSNSYFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFHLWTLGDGLTSLICTILFLSLITTILDTSWYGILWTTKSNQIIEKDFISNSQQLGILLSTDFFLPFELMSIILLVALLGAIAAARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.474 kDa

MDLSESLHDFILVFLGSGLILGSLGVVFFTNTIFSAFSLGLVLVCVSLFYILSNSHFVAASQLLIYVGAINVLIIFAVMFMNGSEYDQNFRVWTVGDGITLMVCTSIFISQINTILDTSWHGIIWTTRPNQILEQDLISTSQQIGIHLSTDFFLPFELISIILLVALIGAIFVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.181 kDa

MGLPGPIHDILLVFLGSGIVLGSLGVILLTNTIYSAFSLGFVLVCISLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMKGSEYSNDFSIWTVGDGVTSLVCTSIFFSLITTILDTSWYGIIWTTRSNQIMEQDLLSNVQQIGIHLVTDFILPFELISIVLLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.187 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYIPSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYNDFHLWTVGDGVTSLLCTSIFVSLITTIPDTSWYGVIWTTRSNQIIEQDLISNGQQIGIHLSTDFFLPFELISIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.245 kDa

MNLPGPIHDFLLVFLGLGLILGGLGVVLLTNPIFSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTVGNGLTSLICTSLFVLLITIISNTTWYGIIWTTRANQIIEQDLVSNGQQIGIHLSTDFFLPFEFISIILLVALIGAIATARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.245 kDa

MNLPGPIHDFLLVFLGLGLILGGLGVVLLTNPIFSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTVGNGLTSLICTSLFVLLITIISNTTWYGIIWTTRANQIIEQDLVSNGQQIGIHLSTDFFLPFEFISIILLVALIGAIATARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.183 kDa

MDLPGLIHDFLLVFLGLGLILGGLGVVLLPNPIYSAFSLGLVFVCISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFINGSEYSKDFHLWTVGDGITSVVCTSLFVSLITTIPDTSWYGIIWTTKANQIIEQDLISNSQQIGIHLSTDFFLPFEFISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.232 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLFCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGNGITSLVCTTILFSLLSTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.121 kDa

MDLPGPIHDILLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFHIPSNSYFVAAAQLLIYVGAVNVLIVFAVMFMNGSEYSKDLYLWTVGDGVTSLVCTSILFSLITTISDTSWYGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVALIGAISMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.171 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTVGDGITSLVCTTILFSLISTILDTSWYGVIWTTRLNQLLEQDLISNSQQIGIHLSTDFFLPFELISIILLVALVGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.461 kDa

MDLPGPIHEILMLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTSIVCITIVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.37 kDa

MDLPKTLHDFLLVFLGSGLILGSLGVVLLTNPIFSAFSLGLTLVCISLLYILSNSHFVAASQLLIYVGAINVLIIFGVMFMNGSEYYQDFRLWTVGDGMTLMVCTSIFISLITTIPDTSWYGIIWTTRSNQIIEQDLISTSQQIGIHLSTDFFLPFELISIILLAALIGAIVVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.425 kDa

MDLPGPIHEILVLFGGFGLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.208 kDa

MDLPGLIHDFLLVFLGLGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFNLWTVGSGVTSLVCTSIFVSLITIIPDTSWYGIIWTTKTNQIIEQDLISNGQQIGIHLSTDFFLPFEFISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.33 kDa

MDLPGPIHDFLLVFLGLGLILGGIGVVLLTNPIYSAFSLGLVLVCISLLYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFNLWTVGNGFTLLICTSIFGLLITTITDTSWYGIIWTTRSNQIIEHDLISNSQQIGIHLSTDFFLPFEFISIILLAALIGAITVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.188 kDa

MDLPAPIHDFLLVFLGLGLIVGGLGVVLLTNPIYSAFSLGLVLVCISLFHIPANSHFVAAAQLLIYVGAINVLIVFAVMFMNGSEYYNDFHLWTVGDGVTSLVCTSIFVSLITTISDTSWYGIIWTTRSNQIIEQDLINKGQQLGIHLSTDFFLPFELISIILLVALIGAIAMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.142 kDa

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDSNLWTVGNGITSLVCTTILFSLMSTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.369 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.369 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.467 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.467 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.368 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGNGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.353 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNAYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.383 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLICTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.467 kDa

MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.443 kDa

MDLPEPLHDFLLVFLGSGLILGSLGVVLFTNPIFSAFSLGLVLVCISLFYILSNSHFVAASQLLIYVGAINVLIIFAVMFMNGSEYYQDFRLWTVGDGITLMVCTSIFVSLITTILDTSWHGIIWTTRPNQIIEQDLISTSQQIGIHLSTDFFLPFELISIILLVALIGAIVVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.187 kDa

MDLPGPIHDFLLVFLGSGLILGALGVVLFTNPIFSAFSLGLVLVCISLFYILANSHFVASAQLLIYVGAINVLIIFSVMFMSGPEYDKKFQLWTVGDGVTSLVCISLFVSLISTILNTSWYGIIWTTKSNQILEQDLINASQQIGIHLSTDFFLPFELISIILLVSLIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.369 kDa

MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSWYGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.106 kDa

MDLPGPIHDFILVFLGLVLILGGLAVVLLPNPIYSAFSLGLVLVCISLLYILSNSHFLAAAQLLIYVGAINVLIIFAVMFLNGSEYYKDLNPWTVGDGVTSVVCTSLFASLITTIPDTSWYGIIWTTKSNQIIEQDLINNSQEIGIHLSTDFLIPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.184 kDa

MDLPGPIHDFLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVFVCISLFYIPSNSHFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFNLWTVGDGVTSVVCTSIFASLITTILDTSWYGIIWTTRSNQIIEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.461 kDa

MDLPGPIHEILMLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTSLVCITIVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.293 kDa

MDLPGPIHDFLLVFLGSGLLFGSLGVVLFPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAITVLIIFAVMFMNDSEYSTDLNRWTVGDGITSVICTTILFSLISTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

176 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

19.311 kDa

MDLPGPIHDFLLVFLGSGLLFGSIGVVLFTNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAITVLIIFAVMFMNDSEYSTDLNRWTVGDGITSLICTTILFSLISTILDTSWYGVIWTTRLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

ndhG

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I subunit 6 family.

17.826 kDa

MEIVQNFSSAALTTGILLGCLGVIFLPSIVYAAFLLGAVFFCLAGIYVLLHADFVAAAQVLVYVGAINVLILFAIMLVNPQDAPPRALDSPPLIPGIACIGLLGVLVQMISTTSWLTPPWTPEPNSLPVLGGHLFSDCLLAFEVMSLVLLVALVGAIVLARREPVERSS