napD

Chaperone NapD

112 amino acids

Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export.

Belongs to the NapD family.

12.123 kDa

MREPDRTPIQRRDILTGKLKQDSGGESRFLHISSAIVTARPDRAADLARHFATLPGTEVHAVQGAKIVLVLEGASVGEIRQPHGAISVMEGVFSANLVFEQILPADEREALS

napD

Chaperone NapD

93 amino acids

Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export.

Belongs to the NapD family.

10.516 kDa

MNNTNLILENARDWHVVGLIVQGNPKKLSAIQTALLAIEHTEIPTLDEKLGKFVVVMQSNDQHLLLEKMESVKDIDGVINVSLVYHEQDEQNK

napD

Chaperone NapD

87 amino acids

Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export.

Belongs to the NapD family.

9.469 kDa

MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP

napD

Chaperone NapD

87 amino acids

Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export (PubMed:17901208, PubMed:22329966). May have a role in the insertion of the NapA molybdenum cofactor (PubMed:24314029).

Belongs to the NapD family.

9.469 kDa

MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP

napD

Chaperone NapD

87 amino acids

Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export.

Belongs to the NapD family.

9.469 kDa

MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP