MYMX

Protein myomixer

84 amino acids

Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers. Involved in membrane fusion downstream of the lipid mixing step mediated by MYMK. Acts by generating membrane stresses via its extracellular C-terminus, leading to drive fusion pore formation. Acts independently of MYMK. Involved in skeletal muscle regeneration in response to injury by mediating the fusion of satellite cells, a population of muscle stem cells, with injured myofibers.

Belongs to the MYMX family.

9.607 kDa

MPTPLLPLLLRLLLSCLLLPAARLARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Mymx

Protein myomixer

84 amino acids

Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers (PubMed:28386024, PubMed:28569745, PubMed:28569755, PubMed:30197239). Involved in membrane fusion downstream of the lipid mixing step mediated by MYMK (PubMed:30197239). Acts by generating membrane stresses via its extracellular C-terminus, leading to drive fusion pore formation (PubMed:30197239). Acts independently of MYMK (PubMed:30197239). Involved in skeletal muscle regeneration in response to injury by mediating the fusion of satellite cells, a population of muscle stem cells, with injured myofibers (PubMed:29581287).

Belongs to the MYMX family.

9.598 kDa

MPVPLLPMVLRSLLSRLLLPVARLARQHLLPLLRRLARRLSSQDMREALLSCLLFVLSQQQPPDSGEASRVDHSQRKERLGPQK

mymx

Protein myomixer

75 amino acids

Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers (PubMed:28386024, PubMed:29078404). Involved in membrane fusion downstream of the lipid mixing step mediated by mymk. Acts by generating membrane stresses via its extracellular C-terminus, leading to drive fusion pore formation (By similarity).

Belongs to the MYMX family.

8.328 kDa

MPAVFLLLRSLVVRLFGSRLAASGVQLLRRILTTATGHLGTVLRNIWERISSQQSKEAILGCVLCLLNMHKKVDN