mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

322 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.963 kDa

MFYYPGKEQKVCDICGVKVGGQPGEYPTVLAGTIFYAGHKIVKDEDKGIFDEEAAEELIKMEEELADETGNPMMAHIMGESEEAIIRYLDWVADVTDAPIIVDSTEAEVKVAAVKHAQEVGLAERVVYNSINASVEDEEIQAIKESDCNSAIVLAFNPMDASVEGRMKILTEGEEGVSEKGMLEISDECGIENPLIDTAYTPFGSGAGTAYKVTLAVKAKLGLPVGGAPHNVPSAWDWLRDFMKKLKEEGKEEWAELAHESSDWGSNVVAATLCCDYLLFGPIENAPAIWPVVAMVDALIVEANEDVGVEPQVEEHPANIVR

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

319 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.179 kDa

MFKFDKEQMVIEIAGRKFGGQPGEYPTGLSGTIFYARHKIVEDEIKGIFDKSAAEALINKQAEMEDTTGNPALVQVFGGNPEALTKYIDFVAEVWDGPMLLDSTSGEARMAAATRATEAGYANQCIYNSINVSIDEAEFQNLVESDIEASIVLCFDPMDPSVEGKLNVLLDGGKTTDTGMLDLAEKAGIKYPLIDVACTPLGSGAGQSVRASFAVKAKLGLPVGSGIHNIPSAWDWLRDFRKGLREAGQTQLAKDVHHVCDIGANIVQTMGSGDFVLYGPIDNAELAFPAVAMTDMVIAETAKDMGTVPVDTHPINKLL

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

319 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.603 kDa

MFKFDREQMVVEIAGRKIGGQPGEYPTALAGTIFYARHKIVEDERKGIFDKAAAEDLINKQAEMEDITGNPALVQVFGGTPEALVNYIDFVAEVWDGPMLLDSTSGEARMAAAKRATEAGYAKQCIYNSINVSIDEQEYQVLVESDLEASIVLCFDPMDPTVEGKINVLTNGGKTADKGMLELAEKAGIKYPLIDTAVTPLGNGAGAAVRASFAVKALFGYPVGSGIHNIPSAWDWLREFRKQLREAGEREKAKDIHHVCDVGANLVQVMASGDFVLYGPIDNAYMTFPAVAMVDAIIAEAAKELGIEPIDTHPFKKLV

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

319 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.296 kDa

MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYARHKIVEDAKKGIFDKKAAEALINKQAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDSTSGKARMAAANRATEAGYAKQCVYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVGGKLNVLNDGGKTKDIGMLELAEKAGIKYPLIDVAVTPMGNGAGHAVRASFAVKAKLGLPVGSGIHNVPSAWDWLREFRKGLREEGKDQISKDVHHVCDIGANIVQTMASGDYVLYGPIDNAELAFPAVAMTDMIIAETAKEMGTATVAEHPLNKLI

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

319 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.348 kDa

MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYSRHKIVEDAKKGIFDKKAAEALINKQAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDSTSGKARMAAANRATEAGYANQCIYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVAGKLNVLNDGGKTKDIGMLELAEKAGIKYPLIDVAVTPMGNGAGHAVRAAFAVKAKLGLPVGSGIHNVPSAWDWLREFRKGLREEGKDQIAKDVHHVCDIGANIVQTMTSGDYVLYGPIDNAELAFPAVAMTDMIIAETAKEMGTVPVAEHPLNKLI

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

319 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.222 kDa

MFRFDKEQMVIDFAGAKFGGQPGEYPTALSGTIFYARHKIVEDAKKGIFDKKAAEALINKQAEMQDITGNSALVQVFGGTEEALVNYIDFVSEVWEGPMLLDSTSGKARMAAAKRATEAGYAKQCIYNSINVSIDEEEFQSLAESDVEASIVLCFDPMDPSVEGKLNVLNNGGKTKDVGMLDLAEKAGIKYPLIDVAVTPMGAGAGNAVRASFAVKAKLGLAVGSGIHNVPSAWDWLREFRKGLREEGKEQIAKDVHHVCDIGANIVQTMASGDFVLYGPIDNAELAFPAVAMTDMIIAETAKELGTTPAAVHPLNKLI

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

316 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.112 kDa

MFKFDRKQEVYEVGGVKFGGQPGEYPTVLVSTMFYARHKIVTDEDKGIFDRAAAETLWNTQVSLSDATGNPYVNQIVGETPESIRKYIDWFIEIDDKTPFLIDSSAGEVRAAAAQYCTEIGVANRAIHNSINASIEQSEIDILTESDVEAAIVLAFNATDPTVKGKLDILEVGGSGQTKGMLQVAEECGIKIPLIDVAAMPLGAGSGATIRSIPTIKGKLGLPVGGGYHNMASAWDWLRKFKKTQPDPKAIYMPADIGTNLVAQIAGSDFLLYGPIENVEKVFPAVAMVDIMLGETAKELGVEIADSENHPVTRLT

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

316 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.256 kDa

MFKFDKKQEVFEIGGVKFGGQPGEFPTVLVSTMFYARHKIVTDEDKGIFDRAAAETLWNTQVSLSDATGNPYVNQIVGETPESIKRYIDWFVEIDDRTPFLIDSSAGNVRAAAAQYCTEIGVADRAIHNSINASIEQEEIDVLTESDVEAAIVLAFNATDPTVKGKMDILEVGGSGLTKGMLQISEECGIKYPLIDVAAMPLGAGSGPTIRSIPTMKAKFGLPIGGGYHNMASAWDWLRKFKKTQPDAKAIYMPADIGTNLVAQIAGSDYLLYGPIENVNQIFPAVAMVDIMLGETAKDLGVEIADLENHPVTKLT

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

316 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

34.044 kDa

MFKFDKKQEVFELGGVKFGGQPGENPTVLVSTMFYARHKIVTDEDKGIFDRAAAETLWNTQVSLSDATGLPYVNQIVGETPESIKRYIEWFVGIDDRTPFLIDSSAGNVRAAAAQYCTEIGVADRAIHNSINASIEQSEIDVLTESDVSAAIVLAFNATDPTVKGKIDILEVGGSGQTKGMLQVAKECGIKYPIIDVAAMPLGAGSGATIRSVPTLKGKFGLPIGGGYHNMASAWDWLRKFKKTQPDPKAIYMPTDIGTNLVAQIAGSDYLLYGPIENVNQIFPAVAMVDIMLGETAKELGVEIADLENHPVTKLT

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

310 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

33.428 kDa

MFRFDKEQIVLDIAGTKIGGQPGEYPTVLAGTIFYGGHSIIEDEKAGVFDKDKAEALIKTQEEMSDVTGNPHIVQTFGQTPEAIVKYLEFVGDVTDAPFFIDSTSGEARIAGANYASEVGLEDRAIYNSVNMAADEAELEALKETKLSASIVLGFNPMDPTVDGKIGIWEDGAGTIDKGLLEMAAECGIDKYLMDVAVTPLGQGAGVAVRTSFAVKSKWGYPVGSGIHNVPSAWDWLREYKKDHKEAWPVCDVGSNLIQQMAGGDFVLYGPIENAKMAFPACAMADIFISEAAKDIGTEPVEDHPFFKLL

mtrH

Tetrahydromethanopterin S-methyltransferase subunit H

310 amino acids

Part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This is an energy-conserving, sodium-ion translocating step. MtrH catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin to the corrinoid prosthetic group of MtrA.

Belongs to the MtrH family.

33.474 kDa

MFRFDKEQIVLDIAGTKIGGQPGEYPTVLAGTIFYGGHSIIEDEKAGVFDKDKAEALIKTQEEMSDVTGNPHIVQTFGQTPEAIVKYLEFVGDITDAPFFIDSTSGEARIAGAEYASEVGLEDRAIYNSVNMAADESELEALKNTKLSASIVLGFNPMDPTVEGKIGIWEDGAGTIDKGLLEMAADCGIDKYLMDVAVTPLGQGAGVAVRTSFAVKSKWGYPVGSGIHNVPSAWDWLREYKKEHKEAWPVCDVGSNLIQQMAGGDFVLYGPIENARMAFPACAMADIFISEAAKDIGTEAVEDHPFFKLL