mtnP

S-methyl-5'-thioadenosine phosphorylase

326 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

35.319 kDa

MGMIISMAMTAVTIWTKTKPGRVSCFIRKNSTMVNAPIGIIGGSGLYQMEALKNVEEVTLDTPFGAPSDSFIVGELAGVRVAFLARHGRGHHLLPSEIPFRANIHGMKQLGVKYLISASAVGSLQAEAKPLDMVVPDQFIDRTRQRISTFFGEGIVAHIGFGNPICPQLAQCLSTAIAGLELEGVTLHDRGTYVSMEGPAFSTIAESNLYRSWGGTVIGMTNLPEAKLAREAEIAYATLALVTDYDCWHPDHDHVTVEMVIGNLQKNAVNAQQVILETVKQLAANPFESIAHRALQYAVLTPPDKFPAATYEKLSLLLGKYYPPAP

mtnP

S-methyl-5'-thioadenosine phosphorylase

326 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

35.319 kDa

MGMIISMAMTAVTIWTKTKPGRVSCFIRKNSTMVNAPIGIIGGSGLYQMEALKNVEEVTLDTPFGAPSDSFIVGELAGVRVAFLARHGRGHHLLPSEIPFRANIHGMKQLGVKYLISASAVGSLQAEAKPLDMVVPDQFIDRTRQRISTFFGEGIVAHIGFGNPICPQLAQCLSTAIAGLELEGVTLHDRGTYVSMEGPAFSTIAESNLYRSWGGTVIGMTNLPEAKLAREAEIAYATLALVTDYDCWHPDHDHVTVEMVIGNLQKNAVNAQQVILETVKQLAANPFESIAHRALQYAVLTPPDKFPAATYEKLSLLLGKYYPPAP

mtnP

S-methyl-5'-thioadenosine phosphorylase

314 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

35.041 kDa

MINKHFSSEEIEQDGKSCLLKNARLGVLGGSGLYSIDSIENIKELDIETPYGKPSDSLRIGNLGGMEVVFLARHGRHHIYTPTEIPYRANIWALRSLNVRWILSPSAVGSLQEQVRPLDMVVPDQFIDRTHQRPLTFFCDGAVAHVTMADPFCPTLSRLLAEEGELLMPEARQVHKGGTYLAMEGPAFSTRAESQLYRSWGCKVIGMTNHTEARLAREAEIAYTSLSMVTDYDCWHEGFGNVSVDLVIENLAANAKLASKIVEATAKRISKLLPPSEAHTALKNSLMTSKDKVSETTREKINLFTENYWGKFNK

mtnP

S-methyl-5'-thioadenosine phosphorylase

299 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

32.753 kDa

MSYPQARIGVIGGSGLYQMADLADTVEVQFNTPFGPPSDALVIGTLAGERVAFLPRHGRGHRLLPAELPFQANIYAMKMLGVEYLLSASAVGSLREEYRPRDIVFPDQFFDRTKDRPSTFFGGGLVAHIGFDQPICTELAHLAAEAARGVELIGETRIHTGGTYVCMEGPAFSTLAESRLYRSWGMDIIGMTNLQEAKLAREAEICYATMALVTDYDCWHPDHGAVTVELIIDNLHKNAENAQRIVRAVVERLHAAAPPCASHSALKYALLTQPEDVPQATKQKLAAILAKYPAYRPEV

mtnP

S-methyl-5'-thioadenosine phosphorylase

294 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

32.078 kDa

MSEAYRQPVLGVIGGSGVYDIDGLEGARWQTVESPFGDVSDQILRGTLDGLEMAFLPRHGRGHVLAPSDVNYRANIDALKRAGVTEILSVSAVGSLAEDLPPGTFVIADQFIDRTFAREKSFFGKGLVAHVSMAHPVSAWLGDRVEEVLADLAIPHRRGGTYLCMEGPQFSTLAESNLYRQWGCHVIGMTNMPEAKLAREAEIAYCTVAMVTDFDCWHPDHDHVSVEAVVRVLLQNADKARSLVKAMPAKLKDRPYPLPDGSHRSLDNAIITHPDRRNPGMARKLSAVAGRVLG

mtnP

S-methyl-5'-thioadenosine phosphorylase

292 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.561 kDa

MQAEIGIIGGSGLYSMPGVSDVQEVRVTTPFGEPSDPYVLGTLAGRKVAFLARHGRGHRLLPTELNFRANIHGFKQLGVERIISVSAVGSLKEEHRPLEFVIPDQFYDRTKQRVSTFFGEGIVAHVGFGDPVCGEMAKVVKHATDKAGVVAKAGGTYVCMEGPQFSTKAESNLYRSWGFDVIGMTNLQEAKLAREAELCYVTVAMVTDYDCWHPDHDAVTVDQIVAVLLKNAENACSVVREAVAAMPKDRTCKCGSALATAIITNKDVVPAATKEKLKLIIGKYFGEQKAGA

mtnP

S-methyl-5'-thioadenosine phosphorylase

291 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.461 kDa

MTQAVLGIIGGSGIYDLPGLEGAHEEVIKSPWGEPSAPLRRGTIAGLPIVFLPRHDKGHRLSPSDINYRANIDVLKRAGVTDLISLSACGSFKEEMPPGTFVLVDQFVDRTHKRESSFFGRGCVAHVSMAHPVSPRLRIHLAAAAEAEGIAIARGGTYVCMEGPQFSTYAESMTYKTSGYSVIGMTNMPEAKLAREAEICYATVAMVTDFDCWHPDHDAVTVQDIIRVLTSNADKAKALVARLAKDFPREHEPCPIGSDRALDTALITAPEARDPELLKKLDAVAGRVLRG

mtnP

S-methyl-5'-thioadenosine phosphorylase

290 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.95 kDa

MKTMIGVIGGSGVYEIDGLEDAVWTKVETPWGDPSDEILTGRLDGVPMAFLPRHGRGHVHSPTTVPYRANIDALKRLGVTDLVSVSACGSFREEMAPGDFVIVDQFIDRSFARAKSFFGSGCVAHVSLAHPTCGRLSALCAEAARATGVTVHEGGTYLCMEGPQFSTLAESLLYKSWGCHVIGMTNMPEAKLAREAEICYASVAMVTDYDSWHPHHGEVDITAIIATLGTNADHARGLVAGLPARLGTERDLCPHGCDRALDHALMTAPAKRDPELLAKLDAVAGRVLKG

mtnP

S-methyl-5'-thioadenosine phosphorylase

289 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.354 kDa

MTAKIGIIGGSGLYKMEALTDVEEVRLTTPFGDPSDAFICGKIGGVPVVFLARHGRHHHLLPTEIPFRANIYGFKSLGVEYLLSASAVGSLQEAVKPLDIVVPDQFIDRTRNRISTFFGDGIVAHIGFADPVCPALAGVLADAIADLNLPDVTLHRQGTYVCMEGPAFSTLAESNLYRSWGGTVIGMTNLPEAKLAREAEIAYATLALVTDYDCWHPEHDSVTVEMIMGNLQRNVKNAQAIICETVKRVHAHPPVSKAHRALKNAILTPLDQVPAATKEKLHLLLAKYL

mtnP

S-methyl-5'-thioadenosine phosphorylase

288 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.271 kDa

MHSATIGVIGGSGLYAMPDLKNPEEVRLTTPFGDPSDAFIIGELEGRRVAFLPRHGRGHRLNPSEVPARANIYAFKLLGVRALISVSAVGSLREDYAPGHAVIPDQIFDRTKGIRPATFFEGGVVAHVAFDRPFCPYLSNILLHAAQAAGAVVHQGGTLVVMEGPQFSTKAESEENRRRGHSLIGMTALPEAKLAREAEIAYATLAMVTDYDVWHPEHDAVTAEQVIKVLSANVNLSQQIVRHAVAQIDENFTSPAHDALRYAIVTHPDHIPAAVKERLAPIAGRYWS

mtnP

S-methyl-5'-thioadenosine phosphorylase

287 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

32.069 kDa

MSYNVRVAIIGGTGLYSLEGMELIEEIFPDTPWGKPSDKIKIGKYKGKLIAFLPRHGIGHFLSPPEVPNHANICALKQLGVEEIVAFSSVGSLREEIKPLDFVLPSQIIDRTRFRNSTYFGNGVVAHAPFAEPFSPNLSKRIAQTAKKIGLEIHLDKTLVCMEGPLFSTKAESHLYRSWGADIINMTVLPEAKLAREAEIAYQMICMSTDYDCWREGEESVTVEMVIANLTKNAETAKKLLSELIHVLGNGDDLSLKNSTRYSIITAPEKRNPETVKKLRVLFPEYF

mtnP

S-methyl-5'-thioadenosine phosphorylase

287 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

32.031 kDa

MSYNVRAAIIGGTGLYSLEGMELIEEIFPDTPWGKPSDKIKIGKYKGKLIAFLPRHGIGHFLSPPEVPNHANICALKQLGVEEIVAFSSVGSLREEIKPLDFVLPSQIIDRTRFRNSTYFGNGVVAHAPFAEPFSPNLSKRIAQTAKKIGLEIHLDKTLVCMEGPLFSTKAESHLYRSWGADIINMTVLPEAKLAREAEIAYQMICMSTDYDCWREGEESVTVEMVIANLTKNAETAKKLLSELIHVLGNGDDLSLKNSTRYSIITAPEKRNSETVKKLRVLFPEYF

mtnP

S-methyl-5'-thioadenosine phosphorylase

286 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.105 kDa

MEQVIGVIGGSGLYEMEGLQDVRSIVVETPFGAPSDEFVTGVLDGVRMVFLPRHGRGHRLLPTEVNYRANIYGMKKLGVTRIISVSAVGSMREEIVPGHIVIPDQFIDRTNATRANTFFGNGVVAHIQFADPVCADLSADLYAAAQEAGATVHRGGTYICMEGPAFSTRAESNLYRSFGVSVIGMTNIPEAKLAREAEICYGVIALATDYDCWHESHDDVSVDAIIAIIKQNVAMAKSIIRNAVRRIDRERNCPCASALRYAIITDKAAIPAETKERLDLIIGSYV

mtnP

S-methyl-5'-thioadenosine phosphorylase

279 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.014 kDa

MVKLTNPPKSPKELGFDEFPSIGIIGGSGLYDPGIFENAVEVQIHTPYGLPSDNVIVGRVAGRVVAFLPRHGRGHKYPPHKIPYRANIYSLYMLGVRSIVAVSAVGSLRPDYAPGDFVVPDQFVDMTKGREYTFYDGPRTCHIQIGLEPFTQEIRQILIETAKKYNRTHDGGCYVCIEGPRFSTKAESRIWREVFGCDIIGMTLVPEINLARELGMCYGLIALVTDYDIWVPHQPVTAEAVEKMMTEKLGIIKKVIAEAVPKLPAELPKCSETLKYACV

mtnP

S-methyl-5'-thioadenosine phosphorylase

275 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.737 kDa

MFEITRPPGVRAHVGVIGGSGLYDPGIVENPVEVKVSTPYGNPSDFIVVGDVAGVKVAFLPRHGRGHRIPPHAINYRANIWALKALGVKWVISVSAVGSLREDYRPGDFVVPDQFIDMTKNRRHYTFYDGPVTVHVSMADPFCEDLRQRLIDSGRRLGYTVHERGTYVCIEGPRFSTRAESRVWKDVFKADIIGMTLVPEINLACEAQLCYATLAMVTDYDVWADRPVTAEEVERVMISNVERARRMLYDVIPKLAGEPELERCSCCRALDTAAI

mtnP

S-methyl-5'-thioadenosine phosphorylase

274 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.784 kDa

MPDFPPKPSVKADIAIIGGSGLYDPGVLENAKEYKIYTPYGEPSDYIIVGELGGKRVAFLPRHGRGHRIPPHKINYRANIWALKMLGVKWVIAVSAVGSLREDYKPGDIVVPDQFIDMTKSRVYTFFDEGIVAHVSMADPFCEHLRQEIISTARELGYRVHPRGTYICIEGPRFSTRAESRVWREVFKADIIGMTLVPEVNLACEAQLCYATIALVTDYDVWAERPVTAEEVARVMKENTEKAKKILYKLIPRLPPEPDKARCSCCSSLETALL

mtnP

S-methyl-5'-thioadenosine phosphorylase

270 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.141 kDa

MIEQNEKASIGIIGGSGLYDPGIFSESKEIKVYTPYGQPSDFITIGKIGNKSVAFLPRHGRGHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDGPVVAHVSMADPFCNSLRKLAIETAKELNIKTHESGTYICIEGPRFSTRAESRTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIPVTAEEVTRVMAENTEKAKKLLYALIQKLPEKPEEGSCSCCNSLKTALV

mtnP

S-methyl-5'-thioadenosine phosphorylase

264 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Prefers MTA, with 2% activity on adenosine, 0.8% activity on S-adenosyl-L-homocysteine and no activity on other tested nucleosides.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

27.964 kDa

MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTIGVHDVAFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVVPDQLVDRTSGRADTYFDFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFSTRAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFAAFGENIELLKRLVRAAIDRVADERTCTHCQHHAGVPLPFELP

mtnP

S-methyl-5'-thioadenosine phosphorylase

263 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.043 kDa

MEKDVEIGIFGGTGIYDSGLLEDAKEVDIDTPYGKPSDTITVGTFKGRKIAFLPRHGKKHTIPPHMINFKANIWAFKELGVTRIIAPSAVGSLKEELAPGHFVLPTQFLDFTKSRDGSFSEDGRVIHISVADPFCPELQSSITEVTDSLDMNIHKDCTYVCIEGPRFSTKAESKFYRTTGADIIGMTLVPECQLAREAQICYASISTVTDYDVWAEKPVTAKEVLETLSKNVEGTKKILTELIEKIPKDRSCSCAKALEEAEF

mtnP

S-methyl-5'-thioadenosine phosphorylase

262 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.467 kDa

MEKVKIGIIGGSGLYSPDFLTNPKEEKIYTPYGPPSSHVVIGEIAGRKVAFIPRHGKRHEIPPHKVNYRANIYALKELGVERLISVSAVGSLREDYKPGDFVCTDQFIDMTKGRVYTFYDGPVVAHVSMADPFCPELRELCIRSARKLGITMHEKGTYICIEGPRFSTRAESRLWRQFGADIIGMTLVPEVNLAREARMCFLNIAMVTDYDVWAEKPVTAHEVARVMAENTEKVKRLLADLIPSIPEERKCQCARALDEALI

mtnP

S-methyl-5'-thioadenosine phosphorylase

261 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.364 kDa

MTVNMAYIGIIGGSGLYDLMPESTKKVIETPFGNPSDAVEIGEVNGVEVAFLPRHGKKHTIPPHKVNYRANIWALHELGVERIIGLNAVGSLREDYKPGEIVIPDQYIDFTKRRDLTFYDGPQVYHISEADPFCPEMNSILYDTARNLKIPVHNSGTYITIEGPRFSTRAESKMFRQFADIIGMTLVPEVSLAGELALCYSVIASITDYDVWSTKPVDAREVMNIMKQNDHKVRDILFNALPLIKKERKCSCSLRLDNAKM

mtnP

S-methyl-5'-thioadenosine phosphorylase

259 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

27.723 kDa

MMLGVIGGSGFYTFFGSDARAVSVETPYGPPSAPITVGTVGDHEVAFLPRHGVKHEFSPHTVPYRANLWALRSLGVRRVFAPCAVGSLTPDLGPGSIVVPDQLVDRTSGRDDTYFDSGGIHVAFADPYCPTLRAAATGLPGVVDGGTMVVIQGPRFSTRAESRWFASQGFTLVNMTGYPEAVLARELEMCYAAVALVTDLDAGIEVGSGVRAVDVFAEFERNMPPFKKLVFEALEAVEVERTCTHCLTHSGVQLPFELP

mtnP

S-methyl-5'-thioadenosine phosphorylase

257 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.22 kDa

MPKIGIIGGSGVYGIFEPKETVKVHTPYGRPSAPVEIGEIEGVEVAFIPRHGKYHEFPPHEVPYRANIWALHELGVERVIAVNAVGSLKEEYKPGDIVIIDQFIDFTKKREYTFYNGPRVAHISMADPFCPELRRIFIETAKELNLPVHEKGTYICIEGPRFSTRAESRMFRQFADVIGMTLVPEVNLARELGMCYVNISTVTDYDVWAEKPVDAQEVLRVMKENEEKVQKLLKRAIPKIPEERKCGCADVLKTMFV

mtnP

S-methyl-5'-thioadenosine phosphorylase

257 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.175 kDa

MPKIGIIGGSGVYGVFEPKEVVKVHTPYGRPSAPIEIGEIEGVEVAFIPRHGKYHEFPPHQVPYRANIWALHELGVERVIAINAVGSLKEEYKPGDIVIIDQFIDFTKKREYTFYNGPKVAHVSMADPFCPELRKIFIETAKELNLPVHERGTYVCIEGPRFSTRAESRMFRQFADVIGMTLVPEVNLARELGMCYVNISTVTDYDVWAEKPVDAQEVLRVMKENEEKVQKLLKRAIPKIPEERKCGCADVLKTMFV

mtnP

S-methyl-5'-thioadenosine phosphorylase

257 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

29.076 kDa

MPRIGIIGGSGVYGVFEPKETVKVHTPYGRPSAPVEIGEIEGVEVAFIPRHGKHHEFPPHEVPYRANIWALKELGVERVIGITAVGSLREEYKPGDIVITDQFIDFTKKRDYTFYNGPRVAHVSMADPFCPEMRKIFYETAKELGFPVHEKGTYVCIEGPRFSTRAESFMFRQFAHIIGMTLVPEVNLARELGMCYVNIATVTDYDVWADKPVDAQEVLKVMAENNYKVQELLKKGIPKIPEERHCGCADVLKTMFV

mtnP

Probable S-methyl-5'-thioinosine phosphorylase

248 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioinosine (MTI) to hypoxanthine and 5-methylthioribose-1-phosphate. Involved in the breakdown of S-methyl-5'-thioadenosine (MTA), a major by-product of polyamine biosynthesis. Catabolism of (MTA) occurs via deamination to MTI and phosphorolysis to hypoxanthine.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

26.809 kDa

MQTIALAVIGGTGVYTLSQFDDVQVYEVETLYGRPSGPIRVGMLFGQRVAFFARHGEEHALPPHKINYRANIAALQQLGVSRVLALNTVGGINEAFGPRTLVCPDQLIDYTWGRVSTFCEEVGSEVLHVDFGHPYSPLLRGCLLRAARDVDVSLVEYGCYGVTQGPRLETIAEIDRLRRDGCDLVGMTGMPEAALAREKGLEYACLGIVSNWAAGCGDGAEITMGEILSNVATAFSCLPELISKVARE

mtnP

S-methyl-5'-thioadenosine phosphorylase

240 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

25.982 kDa

MLDNAEELSMDTPYGAPSDTITLGGIGGRRLAFIPRHGKKHNIAPHKINYRANIWALQKLGVSRVVAPSAVGSLREELAPGRFVVPSQFLDFTRTREGSFSEDGRVIHISVAEPFCPELRTVLLDAAGDAHDGGTYACIEGPRFSTRAESALFRAAGADIIGMTMVPECQLSREAQMCYASVSTVTDYDAWAEKAVTAKEVLATLADNVERTKALLAKLIPTIPRDRKCTCADALAEAEF