mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

269 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

28.666 kDa

MTVGVFAALGEEVARVRECLGGVGTERAGLTFYVVSVGALQVVYVCGGVGKVNAALCTQLLISEFGARVLINTGIAGALDERLCVFDVLVSVDAVQHDVDVTAFGYQKGRIPRMDSVEWTANTALRYLVREAFDLCTRDPEWTEGACALSGSGDPPSRVSRLVEGRVASGDLFVSDAQTRARIIREFGAHGVEMEGAAFAHVASVNGVPFVIIRCISDGAGAEQDVSMSYKEFSTRAARRSALLTLRVLERLSALRTSVVASLFPMVVV

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

255 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

27.34 kDa

MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRVVLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGLLTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPRIYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLAGADSGVDFNRFVGEVAASSARVLLRLLPVLTAC

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

255 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

27.34 kDa

MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRVVLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGLLTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPRIYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLAGADSGVDFNRFVGEVAASSARVLLRLLPVLTAC

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

255 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

27.34 kDa

MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRVVLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGLLTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPRIYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLAGADSGVDFNRFVGEVAASSARVLLRLLPVLTAC

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

252 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

28.426 kDa

MKKEIKKNYRIGIIAALQQEVQILFNKLKNYKINKISNITFYIGNIHNIHVVLAKSGVGKVFSGITCALLLQKYKVKFIINIGSAGSLNKNLKPGSIIIPTNVCYHDVNLTAFGYSIGQIKNCPKTFLSNTLMLKLTEKYLFENKIKYQKKLMISGDIFIDTCEKKSLLKKRFPKAIAVDMEAAAIAHVCYQFNIPILIIKSISDSSDINAADNFKYFINLASKNSSLVTINVLQTLFKNTKNILFDNNNRC

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

243 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.528 kDa

MKAGIIGAMEPEVAILKEKLTDAKSTEHAGYTFHQGQLDGSDVVIVQSGIGKVAAALATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQLPANPAAFMPHDDLVAAAKKGIEQLSQTAGENIKAVTGLITTGDTFMTKEEDVAKARANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGKESPHTFEEYLETAAVNSSQLVLNMLGQLKGKVLSAA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

237 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.704 kDa

MKVGIIGAMKEEVTLLCQKIQSCQTLTRAGCSIYSGFLGETNVVLLQSGIGKTSAALGTTLLLEYFQPDILINTGSAAGLWPDLKIGDIVISTEVRYHDVNVTAFGYEWGQMALCPPAFFADKKLIEIVLECVKNLNLNAVQGLICSGDAFINGDQALDRIRTFFPKAVAVEMEAAAIAQVCHQFETPFVVIRAISDVADQASHLSFEQFLCIAAQRSSTVIENMLPILAETYCSIN

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.177 kDa

MKAAIIGAMEEEVAILRSRMEEREEVVIAGCEFSTGRLDGVEAVLLKSGIGKVNAAMGTTLLLDRFRPDFVINTGSAGGFLPSLRVGDLVISDEVVHHDVDVTAFGYAYGQVPGLPARYRADEALVEAAKQAAAQLDGLQAAIGLIATGDSFMNDPKRVEFVRGQFPELCAVEMEAAAIAQVCVQFGTPFVIIRALSDIAGEESNVSFEQFLETAAKHSAELVLSMLTVVQSKAKQ

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.63 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLNPSAVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.663 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAMINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLNPSAVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.644 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFVPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPIRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLNPSAIK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.63 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLNPSAVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.883 kDa

MKIGIIGAMEPEVAHLIAAMTNTSSQTIADIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIAQLGEVRAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDAYIVKAGYHSALMVMLLLEQLEPNSVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.74 kDa

MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFADSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLDPNSVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.826 kDa

MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIKQLGEVKAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLDPNSVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

236 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.858 kDa

MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIKQLGEVKAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGMPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLDPNSVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

235 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

26.103 kDa

MKIGIIGAIEQEIRKIKEIINNLKIKKIGNIKIYTGTFKKIEIFLILSGIGKVSASMSTTISINLFQPDFIINSGSAGSLNACLKIGDIIIPKKTCYYDVDLTNFGYSKGQIPEYPQTFKTNKNLREILKEIAVEFKFKFLTGLLVTGDSFIRKSNCIKKIKNQFSSAIGVDMESTAIGQVCHNFKIPFIIIKSISDLSDNNATSHFEKNIPIASLKSSKLVKLLLKKISSQNSI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

235 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.016 kDa

MRKIAIIGAMAEEVERLASHLENRQTRQHAGSTFHSGHLHGVEVVILQSGIGKVNAAVGTTQLLEAYQPDAVINTGSAGGFGVDLDVGDVVISSEVRHHDVDAVVFGYEYGQVPQMPAAYAPDPHLVNVARECIEGLGELRVAEGLICTGDIFMADKAAVDQARERFPSMLAAEMEAAAIAQTCHLYGCPFVVIRALSDIAGKESDLSFQAFIEKAATHSAMMVEAMVKRLGTAS

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

235 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.114 kDa

MKAAIIGAMEEEVAILRSRMEGCEETVIAGCEFSKGRLDGVEAVLLKSGIGKVNAAMGTTLLLDHFRPDFVINTGSAGGFLPSLRVGDLVISEEVVHHDVDVTAFGYAYGQVPGLPARYRADEALVEAAKQAAARLDGLQAVTGLIATGDSFMNDPKRVEFVRGQFPELCAVEMEAAAIAQVCVQFGTPFVIIRALSDIAGEESGVSFEQFLETAAKHSAELVLSMLSVMKQKRY

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

235 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.208 kDa

MRVGVIGAMEQEVKLLREQIENCEIVSRGGCEIYTGKINGVDVALLKSGIGKVAAAIGTTLLLEHFRPDVVINTGSAGGLDAKLNVGDIVVSTEVRYHDADVTAFGYEPGQMAQCPPAFIADPKLVNIAQECIGSLKLNAVRGLICSGDAFINGAEPLARIRRTFPEVVAVEMESTAIGHVCHQFDTPFVVVRAISDVADKESHLSFDEFLSVAAQQSSLMVTTMLDKLKTETQF

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

235 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.883 kDa

MNVGIIGAMEPEVKILREAMQNPQTLTKAGFTFYTGELAGNTVTLVQSGIGKVASTIATTLLIDNFAPDCVINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTAFGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQISDVKTLVGLICTGDIFMCDPIRIEKARSDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEYLETASINSSKMVVALLEKLTAVSL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

234 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.234 kDa

MPIAIIGAMEEEVNLLRNELSERKDTVIANYHFYEGLLNSVPVVILKSGIGKVNAAIGTTLLLDHFKPSSVINTGSAGGFRAGLKVGDVVVSTEVRHHDVDVTAFGYEYGQVPGMPAAYTADPKLIATAEAVIERMDAIRVVHGLIVTGDSFIHDTERSNLIKTNFPDVAAVEMEAAPIAQVCHQFDVPFVVTRSISDSADEEASLSFDEFLEIASINSAKMVMEVVRTLADSE

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

234 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.783 kDa

MKVGIIAAMEEELTLLVDRLDNCEEVQLGHCKYYTGQINGVEVGLMRCGIGKVNAAIGTTLMIDKLKPKCLINTGVAGGFINEMNVGDIVISSSVRHHDADATAFGYELGQIPDMPSEFQADRRLVEMATKVNLKSKARIFEGPVFSGDSFIHTTEQVENILKNFPQIMAVEMEGASIAQTSHLFNIPFVLIRSISDKVRETKSADTYTQSMEESAKNSVQVVFEMVEQLKEGM

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.194 kDa

MKVGIIGAMEEEVNLLRNELTERVDTEIANYHFYEGYLGNMQVVILKSGIGKVNAAIGTTLLIDKFKPDVVINTGSAGGFKKGMKVGDVVVSTEVRHHDVDVTAFGYEYGQVPGMPPAYEADAKLVSVCKDVIENLPDVNVHQGLIVTGDSFINDSKRVADILGHFDGVAAVEMEAAPIAQTCYQFGVPFVVTRSISDSADEEANLSFDEFLETASINSAKMVMAVTKRLEQA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.411 kDa

MTIGIIGAMEEEVELLKNTMPSIEEVIIGGAKFYIGEIAGKEVVLLESGIGKVNAALGTTLLADRFKPEIIINTGSAGGIGEGLAIGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYRDYFADSENKAVYGLVITNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATMSFDEFIHLAAKQSAICIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.305 kDa

MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEIAGKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYREYFAASENKAVYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.333 kDa

MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEIAGKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYREYFAASENKAVYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAARQSATCIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.448 kDa

MKVGIIGAMEQEVTLLRDQIENRQTIQRAGCEIYTGQIGGVDVALLKSGIGKVSAAMGTTLLLEHCKPDLVINTGSAGGLASTLKVGDIVVSEEVRYHDADVTAFGYEPGQMAGCPAAFVADDALIALAESCIKQLNLNAVRGLICSGDAFINGAEPLARIRATFPNVAAVEMEAAAVGHVCHLFGTPFVVVRAISDVADSESHMSFEEFLVVAAKQSTLMVNAMLQTLAKRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.657 kDa

MKIGIIGAMEQEVALLRDRIDHSTLCQQAGCEIYMGQLHGVEVALVKSGIGKVSAALGTTLLLDHFKPELVINTGSAGGLAPSLKVGDIVVSHEVRYHDVDVTAFGYEPGQMAQCPASFNAAPSLVALAEESVDRLGMHAVRGLVVSGDAFINDADGLAHIRQTFPQAIAVEMEATAIAHVCHQFAVPFVVVRAISDVADQASHLSFDEFLTVAAQSSSRLVEEMVQALAGQR

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.291 kDa

MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEVAGKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYREYFAASENKAVYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.381 kDa

MTIGIIGAMEEEVELLKNSMSSVEEIVIGGAKFYIGEIASKEVVLLESGIGKVNAALGTTLMADRFKPEVIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYREYFATSENKAVYGLVVTNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.436 kDa

MTIGIIGAMEEEVELLKNTMPHVEEVVIGGAKFYVGEIAGKEVVLLESGIGKVNAAIGTTLLADRFKPEIIINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAETIYRDYFSQSENKAVYGLVITNDSFIMRPDQHELIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEFIHLAAKQSATCIIELLKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.924 kDa

MKVGVIGAMEQEVTLLRNQIEDRQTLSRGGCEIYTGKLNGVEIALLKSGIGKVSAAIGTTLLLEHCQPDVIINTGSAGGLDPKLQIGDIVVSREVRYHDTDVTAFGYEPGQMAQCPAAFVADDQLIDLAEKCIHSLNLNAVRGLICSGDAFINGAEPLARIRATFPQVTAVEMEAAAIGHVCHQYNTPFVVVRAISDVADKESHISFDEFLAVAARQSTLMVNAMLATLSKDK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.619 kDa

MKVGIIGAMEEEVTLLRDKIENRQTLSRAGCEIYTGQLNGIDVALLKSGIGKVSAAMGTTLLLEHCQPDIVINTGSAGGLASSLKVGDIVVSTEVRYHDADVTAFGYEPGQMAGCPAAFIADLKLIELAESCIKQLDLNAVRGLICSGDAFINGAAPLARIRTTFPSVAAVEMEAAAIGHVCYLFKTPFVVVRAISDVADQESHLSFDEFLVVAAKQSTLMIEAMLTSLAKRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.566 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIEAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.639 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLTRIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIKAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.566 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIEAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.609 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIKAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.609 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIKAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.609 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIKAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.609 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIKAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.566 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIEAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

233 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.566 kDa

MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDLVINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNAVRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEFLVVAAKQSTLMIEAMLTTLAQRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.884 kDa

MNIAIIGAMEEEVAILREKIANRTETTVANCSFYSGTLDGANVVLLKSGIGKVNAAMSTTILLERFAPDVVINTGSAGGFAPSLNVGDIVISTEVVHHDVDVTAFGYAYGQVPGMPARYAADERLIQAAETSAAHIRDIQVAKGLIATGDSFMHDPARVDFVRTQFPDLYAVEMEAAAIAQVCHQFNVPFVVIRALSDIAGKESNVSFEQFLQKAALHSSELVQLMVNELNK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.368 kDa

MKIGIIGAMEEEVTLLRDKIEKRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively. Can also use 5'-isobutylthioadenosine, 5'-n-butylthioadenosine, S-adenosyl-D-homocysteine, decarboxylated adenosylhomocysteine, deaminated adenosylhomocysteine and S-2-aza-adenosylhomocysteine as substrates.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.635 kDa

MKVGIIGAMEQEVTLLRDRIENRQTLRLASGEIYTGRLHGVEVALLKSGIGKVSAAMGTTLLLDHCRPDVVINTGSAGGLASTLRVGDIVISDEVRYHDADVTAFGYQPGQMAGCPAAFSADAALIALAERCIIALQLNAVRGLICSGDAFINGAEPLARIRRTFPQVAAVEMEAAAIGHVCHAFQTPFVVVRAISDVADQESHISFDEFLKVAAEQSTLMVEAMLRAMASQ

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.3 kDa

MKIGIIGAMEEEVTLLRDKIENCQTLSLGGCEIYTGQLNGTDVALLKSGIGKVAAALGATLLLERCKPDVIINTGSAGGLAPSLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDNLIAAAESCIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPNAIAVEMEATAIAHVCHNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTIMVETLVQKLARG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.318 kDa

MKAGIIGAMEQEVTLLRDKIENRQTLTLAGCEIYTGTLNGVDVALLKSGIGKVSAALGTTLLLELCKPDVVINTGSAGGLAATLKVGDIVVSDEVRYHDADVTAFGYEAGQMAGCPAAFKADEKLITAVEQCIHQLDLHAVRGLVVSGDAFINGAAPLAHIRNTFPQAIAVEMEATAIGHVCHQFGTPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLLVEKLLAHLAQG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.502 kDa

MKIGIIGAMEEEVTLLRDKIENRQTCTMGGVEIYTGQLNGTEVALLKSGIGKVAAAMGATLLIDHFKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAEHNLNAVRGLIVSGDAFINGSVSLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHISFDEFLAVAAKQSSLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

26.266 kDa

MKIGIIGAINQETERLKKIIHFYIEKKINTYKIYIGKFKSHDVFLIKSGIGKVSASIATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKYIKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDASDNNATVNFKENIDIVSYQLSKFVKIILENLIDM

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

26.344 kDa

MKIGIIGAINQETERLKKIIHFYIEKKINTYKIYIGKFKSHDVFLIKSGIGKVSASVATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKYIKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDESDNNATVNFKENIDFVSYQLSKFVKIILENLIDM

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

26.266 kDa

MKIGIIGAINQETERLKKIIHFYIEKKINTYKIYIGKFKSHDVFLIKSGIGKVSASIATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKYIKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDASDNNATVNFKENIDIVSYQLSKFVKIILENLIDM

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.33 kDa

MKIGIIGAMEEEVTLLRDKIENRQTITLGGCEIYTGQLNGTEIALLKSGIGKVAAALGATLLLERCKPDVIINTGSAGGLAPTLTVGDIVVSDEARYHDADVTAFGYEFGQLPGCPAGFKADDALIAAAESCIAKLNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.494 kDa

MKAGIIGAMEEEVTLLRDKIDNRQTLTIAGCEIYTGTLNGVDVALLKSGIGKVSAAMGATLLLEHCKPDVIINTGSAGGLAPSLKVGDIVVSDEVRYHDADVTAFGYEYGQMAGCPAAFKADEKLIAAAQETIEKLNLHAVRGLVVSGDAFINGSVNLAKIRHNFPQAIAVEMEATAIGHVCHNFGVPFVVVRAISDVADQQSHLSFEEFLAVAAKQSSLMVETLLTSLNRG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.073 kDa

MKIAIIGAMEEEVTILRDKIEEREETVIANCEFSTGRLNGADVILLKSGIGKVNAAMSTAILLERFRPDYVINTGSAGGFLSTLNVGDVVISNEVVHHDVDVTAFGYEYGQVPGMPARYKADETLVKIAEQNAKQIKDIQVVTGLIATGDSFMNDPARVEFVRSKFPELCAAEMEAAAIAQVCTQFAVPFVIIRALSDIAGKESNVSFEQFLDTAAKHSADLVLSIVSSLQK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.766 kDa

MKLKIGIIGAMAQEIEILRKLMTDVSVLEIAGCKIYEGKINNTCVSLLQSGIGKVSAAMGTTLLLELTKPNMVINTGSAGGLAENLNVGDIVISTEVRHYDVDVTAFGYEIGQLPANPAAFLPNEQLVNMALKETKTAGVNAVAGLICSGDRFVNGAEQITTIRQHFDQVVAVEMEAAAIAQVCYAFEVPFVVVRAISDIADKCSHLSFEEFLPLAAEKSSEIVIAMLNNFS

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.459 kDa

MKVAIIGAMEEEVALLRNQIQNLKTEIHGGFEYYLGQINAIDVILLRSGIGKVNAAIGTALLIKLYEPDYVINTGSAGGFHTDLEVGDIVISQSVCHHDVDVTPFGYARGQVPGHPECYLADIHLIDIAKRSIDALQEVTHMHGLIATGDRFMHLPEDVATTREYFPDMIACEMEAAAVAQTCHAFETPFVIIRSLSDIAGKENAVTFEQYLDKAATHSARLILEMLTHLKS

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.512 kDa

MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSGIGKVAAATGATLLLERCQPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLVAAAEDCIKALDLNAVRGLIVSGDAFINGSVALAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEFLAVAARQSTLMVENLVQNLARG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.504 kDa

MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSGIGKVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADEKLVAAAESCIKALDLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEFLAVAARQSTLMVENLVQNLARG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.412 kDa

MRLKIGIIGAMAQEVEILRNLMVEAKVIEIAGCKIYDGKINNTQVALLQSGIGKVAAAVGTALLLELTKPDVIINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNAVSGLICSGDVFVNGAEKIAQIRQDFPNVAAVEMEAAAIAQVCHAFNVPFVVVRAISDVADKESHLSFDEFLPLAAKNSSEIVVAMLNNFA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.412 kDa

MRLKIGIIGAMAQEVEILRNLMVEAKVIEIAGCKIYDGKINNTQVALLQSGIGKVAAAVGTALLLELTKPDVIINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNAVSGLICSGDVFVNGAEKIAQIRQDFPNVAAVEMEAAAIAQVCHAFNVPFVVVRAISDVADKESHLSFDEFLPLAAKNSSEIVVAMLNNFA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.507 kDa

MRLKIGIIGAMAQEVEILRNLMVEAKVIKMAGCKIYDGKINNTKVALLQSGIGKVSAAIGTTLLLELTKPDMVINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNAVSGLICSGDVFVNGAEKIAQIRQDFPNVAAVEMEAAAIAQVCHAFNVPFVVVRAISDVADKESHLSFDEFLPLAAKNSSEIVVAMLNNFA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.476 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.456 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHSKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.445 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.445 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.445 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.445 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.374 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLGHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.446 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.476 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.446 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.472 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.446 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.446 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.308 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHGKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.354 kDa

MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMVESLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.553 kDa

MKVGIIGAMEQEVTLLRDRIENRQTFQRAGCEIYTGQINGVEVALLKSGIGKVSAALGTTLLLEHSKPDVVINTGSAGGLASTLNVGDIVISDEVRYHDADVTAFGYEPGQMAGCPAAFPADEKFIALAQDAIDDLQLNAVRGLVVSGDAFINGAEPLARIRTTFPKAIAVEMEATAIAHVCHQFGTPFVVVRAISDVADKASHLSFDEFLSVAAQQSTRMVEAILAKLAAR

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.443 kDa

MKVGIIGAMEQEVTLLRDRIENRQTFQRAGCEIYTGQINGVDVALLKSGIGKVSAALGTTLLLEHSKPDVVINTGSAGGLAPSLNVGDIVVSDEVRYHDADVTAFGYEPGQMAGCPAAFAADEKLIALAQEAIADLQLNAVRGLVVSGDAFINGAEPLARIRTTFPKAIAVEMEATAIAHVCHQFAVPFVVVRAISDVADKASHLSFDEFLSVAAQQSTRMVEAILAKLAAR

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.617 kDa

MKIGIIGAMEQEVTILKEQLTDCETHHKAGCIFYTGNLNGADVVLLQSGIGKVAAAVGTAVLLEAFQPDAVLNTGSAGGFDSSLTLGDVVISTEVRYHDADVTAFGYEIGQMAQQPAAFISDEKLILTAEQALASMADMHAVRGLICTGDAFVCTPEKQAFIRDNFPTVIAVEMEAAAIAQACHQFNVPFVVVRAISDVADKESPMSFEEFLPLAAQSSSVMVAKMVEILNQ

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.472 kDa

MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

232 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.588 kDa

MKIGIIGAMEEEVTLLRDKIENRQTLTLGGCEIYTGQLNGTDVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEYCIRELNLNAVRGLIVSGDAFINGSVGLAKIRHNFPNAVAVEMEATAIAHVCYNFKVPFVVVRAISDVADQQSHLNFDEFLAVAAKQSTLMVETLVQKLAHG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.242 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQTEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.226 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEIPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.309 kDa

MRIAVIGAMEEEVRILRDKLEQAEIESVAGCEFTKGMLVGHEVILLKSGIGKVNAAMSTTILLERYQPEKVINTGSAGGFHHALNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADKELVALAEQCMKEEENIQVVKGMIATGDSFMSDPNRVAAIRGKFENLYAVEMEAAAVAQVCHQYNVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLKELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.226 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEIPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.255 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.675 kDa

MTKIGIIGAMDEEVELLKSKLSNCSERTIAECEFYTGTIEGKEIVLLKSGIGKVNAAIGTTLLIQLFQPTAIINTGSAGGLDSSLHVGDLAISTEVRYNDVDATVFGYEFGQVPQMPAFYQPDDMLIDIAIEAAKTVGIPSKKGLILSGDSFMSDAALVEQLKRRFNYPLCSEMEAGAIAQVCHRFGVPFVIIRSLSDIAGAEAKVSYDEFLETASVNSANLVLAIVGRLG

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.227 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFENLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.304 kDa

MKIAVIGAMEEEVTILRSKLEQTNREVIANCEFTSGFYEGKEVVLLKSGIGKVNAAMSTTILLDRFKPDVVINTGSAGGFHHSLNVGDIVISTEVRHHDVDVTAFDYEYGQVPNLPAAYKADNALIQAAEDEASELGHIQVVKGTIATGDSFMSDPDRVAFIRGKFEDLYAVEMEAAAVAQVSYQFNTPFVVIRALSDIAGKESEISFDQFLEQAAKHSTDLVLRMIKRIN

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.232 kDa

MKIAVIGAMEEEVTILRDQLKNATQENIAGCEFTTGVYEDKEVILLKSGIGKVNAAVSTTLLLDRFQPDYVINTGSAGGFHHTLNVGDIVISTDVRHHDVDVTIFNYEYGQVPGLPAAFVADEKLVKLAEESALEIDHIQVAKGTIATGDSFMNDPNRVAFVREKFPELYAVEMEAAAVAQVCQLFGTPFVVVRALSDIAGKESNVSFDQFLEQAAIHSTDLVLRMIKQTQ

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.69 kDa

MKIGIIGAMEEEVNFLRDKMENRVATTIANCEFTEGQIGAVQVVLTRCGIGKVNAALATTLLNDRFQPDAIINTGVAGGLNASMAVGDLVISTEVRYHDVDATVFGYEYGQVPGMVPAYLPDATLIAAAKTAAQKVGFHSEEGLIVTGDSFMGEETRVNEVKTLFPAAYCAEMEAGAIAQVCHQFQTPFVIIRALSDVAGQDAKMSYDTFLEKSAVNSAKQVMLMLDHLSA

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.265 kDa

MRLAVIGAMEEEVTILRNKLENAKTETIAHCEFTTGEYEGTEVILLKSGIGKVNAAISTTLLLDRYKPDYVINTGSAGGFHHTLNVGDVVISTDVRHHDVDVTAFDYEYGQVPGLPAAYAADEKLISITEEAVSELDGIQVAKGTIATGDSFMNDPKRVEEVRARFSDLYAVEMEAAAVAQVCHQFKTPFVVIRALSDIAGKESHVSFDQFLEQAAVHSTELVLKVIKRIH

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.169 kDa

MKLAVIGAMEEEVTILRSKLKDAKQEMIAHCEFTTGSYEGVEVILLKSGIGKVNAAISTTLLLDRFKPDYVINTGSAGGFHHTLNVGDVVISTDVRHHDVDVTAFDYEYGQVPGLPAAYKADEKLISITEEAVSELNGIQVAKGTIATGDSFMNDPKRVEDVRAKFADLYAVEMEAAAVAQVCHQFKTPFVVIRALSDIAGKESDVSFDKFLEQAAVHSTELVLNVIKRIH

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.213 kDa

MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEKVINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVALAEKCMQAEENIQVVKGMIATGDSFMSDPNRVAAIRDKFEDLYAVEMEAAAVAQVCHQYEVPFVIIRALSDIAGKESNVSFDQFLDQAALHSTNFIVKVLEELK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.121 kDa

MKIGIIAAMEEELVLLVNKLDEPKTENFGQFTYHTGRINGVEVALFLCGIGKVNAAVGATLLLDKFKPDYLINTGVAGAFPGNINIGDIVVSSEVRHYDADATAFDYEMGQIPQMPAAYQADKLLLGLAKKAWINEDSISVHQGPVLSGDSFIHTPQQISQIEQKFPDVMAVEMEGAAIAQTGFLFNVPFILIRSISDKVHEDGSSAIYEQSMEKAAANSVRMVLSMLKEL

mtnN

Aminodeoxyfutalosine nucleosidase

231 amino acids

Catalyzes the direct conversion of aminodeoxyfutalosine (AFL) into dehypoxanthine futalosine (DHFL) and adenine via the hydrolysis of the N-glycosidic bond; this reaction seems to represent an essential step in the menaquinone biosynthesis pathway in Helicobacter species. Can also probably catalyzes the hydrolysis of 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively. These other activities highlight the tremendous versatility of the enzyme, which also plays key roles in S-adenosylmethionine recycling and in the biosynthesis of the quorum-sensing molecule autoinducer-2. Does not act on futalosine (FL) as substrate.

Belongs to the PNP/UDP phosphorylase family.

25.209 kDa

MVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMSFDAFLEKSAQTSAKFLKSMVDEL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.583 kDa

MKIGIIGAMEQEVAILKDKIEGLSTVTKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMSDKHAVRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTLLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.583 kDa

MKIGIIGAMEQEVAILKDKIEGLSTVTKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMSDKHAVRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTLLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.597 kDa

MKIGIIGAMEQEVAILKDKIEGLSTITKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMSDKHAVRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEFLPLAAQSSSEMVLNMVTLLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.53 kDa

MKIGIIGAMEQEVAILKEQINGLATTIKAGCTFHTGTLNGAEVVLLQSGIGKVAAAVGTTLLISDHNVDVVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFKADEKLMAVAEKALTQMEDKHAVRGLICTGDAFVCTPERQAFIRSHFPSVIAVEMEASAIAQTCHQFSVPFVVVRAISDVADKESPMSFEEFLPLAAESSSEMVMKMVTLLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.162 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.192 kDa

MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYTPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVKAIEGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSYIVKAGYHSALMVMLLLEQLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.666 kDa

MSVIGLIGAMDEEVAVIKAWMTDVREQTIAGCDFFVGRFEGKDVVLLKSGIGKVNAAVSTTLLLSQFEPEYVINIGSAGGFDPELQVGDVVISDQVVHHDVDVTGFGYLMGQVPNMPATYAADETLVAEAKAALQKVTQVQAKVGLIGTGDSFMNDPVRVEAVRALFPELVAVEMEAAAVAQVCFKFGTPFVVVRSLSDIAGKESPQSFEEYLKVAAENSSLMIQQMLKGN

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.818 kDa

MKIGIIGAMDEEVSILKAKLNNMETTIIAGCEFYQGELNGKQVILTKSGIGKVAAAVATTLLLERFNPGQVINTGSAGGYDTTLNVGDIVISTEVRFHDVDLTAFGYEIGQMAQLPAAFPADKNLIFAAQKAAETITHLKTIQGLICTGDIFMADPTKAEIARHNFPTMAACEMEAAAIAQVCYQFKVPFVIIRSLSDIAGKKSELSFEQYLPIAAKNASILVEEIINNLN

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.525 kDa

MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.749 kDa

MKVGIIGAMEQEVTILKEAMTNCQTVSKAGCTFFSGQINGVDVVLLQSGIGKVAAAVGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTEVRHHDTDVTAFGYEMGQMAGQPAAFKADEKLMDLAEKALAQMENTHAVRGLICTGDAFVCTAERQEFIRKHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFEEFLPLAAKSSSEMVCKMLELTK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.525 kDa

MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.525 kDa

MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDVVINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQLPNTHAVRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEFLPLAAKSSSAMVLKMVELLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.748 kDa

MKVGIIGAMEQEVTILKEAMTNCQTVNKAGCTFFSGQINDVDVVLLQSGIGKVAAAVGTTILLDEYQPDVVINTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMDLAEKALEQMANTHAVRGLICTGDAFVCTAERQAFIRENFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFEEFLPLAAKSSSEMVFKMLELVK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.466 kDa

MKIGIIGAMEQEVAILKAAISDITEVNKGGCTFFSGQLNGVDVVLLQSGIGKVAAAVGTSILLSEYQPDVVLNTGSAGGFDSTLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADDKLMAVAEQALAQMEDKHAVRGLICTGDAFVCTAERQEFIRKHFPSVVAVEMEASAIAQACHQFQVPFVVVRAISDVADKESPMSFEEFLPLAAQSSSEMVIKMVALLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.794 kDa

MKVGIIGAMQQEVAILKEAMTNAQTVNKAGCTFYSGQINGVEVVLLQSGIGKVAAAIGTTILLDEYQPDMVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAGQPAAFLADEKLMNLAEKALEQMDGQHAVRGLICTGDAFVCTAERQAFIRQHFPSVIAVEMEASAIAQTCYQFKVPFVVVRAISDVADKESPMSFEEFLPLAAKSSSEMVFKMLELLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

231 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.768 kDa

MKVGIIGAMQQEVAILKEAMTNAQTVNKAGCTFYSGQINGVEVVLLQSGIGKVAAAIGTTILLDEYQPDMVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAGQPAAFLADEKLMNLAEKALEQMDGQHAVRGLICTGDAFVCTAERQAFIRQHFPSVIAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPMSFEEFLPLAAKSSSEMVFKMLELLK

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.114 kDa

MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDIALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEMAEKQGQSVKRGLICSGDSFINSEDKIAQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEFLPLAAKQSSALVLGMIDRLS

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.411 kDa

MKIGIIGAMAQEVEILLGYMAEPKLTEIAGCKIYEGKINNTDIALLQSGIGKTAAAMGTALLLQLTKPEMVINTGSAGGLDANLNVGDIVISTEVRHHDIDVTAFGYEKGQLPANPAAFMANEQLAQIAIKETEKAGFNAVSGLICSGDLFVNGNDMIARIRNDFPSVKAVEMEAASIAQVCHAFQVPFVVVRAISDVADKESHLSFDEFLPLAAEKSSEIVLAMLNNFA

mtnN

Aminodeoxyfutalosine nucleosidase

230 amino acids

Catalyzes the direct conversion of aminodeoxyfutalosine (AFL) into dehypoxanthine futalosine (DHFL) and adenine via the hydrolysis of the N-glycosidic bond; this reaction seems to represent an essential step in the menaquinone biosynthesis pathway in Helicobacter species. Also catalyzes the hydrolysis of 5'-methylthioadenosine (MTA) to adenine and 5'-methylthioribose. Can also probably use S-adenosylhomocysteine (SAH) as substrate, leading to adenine and S-ribosylhomocysteine. These other activities highlight the tremendous versatility of the enzyme, which also plays key roles in S-adenosylmethionine recycling and in the biosynthesis of the quorum-sensing molecule autoinducer-2.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.02 kDa

MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

23.734 kDa

MKIGIVGAMAQEVEILAGLMTDKTEHKIGSAVVFEGEVNGKSVVLLQSGIGKVAAAIGTTVLLQGFKPDVVINTGSAGGVAQGLKVGDIVISTETAYHDADVTAFGYAKGQLPACPATFKSDEKLTALAEKIAQKQGRRVKQGLICSGDSFIAGGERLAQIKADFPPVTAVEMEAAAIAHVCHAFGVPFVVVRAISDAGDGEAGMSFEEFLPIAAKQSCEMVLGMLAELE

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.505 kDa

MKVGIIGAMEQEVALLRSQMSNPTTLQLGGCEFYQGTLAGKEVILTRSGIGKVAASVATSLLLEKFAPDCVINTGSAGGFAQDLHIGDVVIASEMRFHDVDVTAFGYEMGQMAQQPAAFPCDETLIAVAQDCIAEQGKHQTKVGLICTGDQFMCKPDAIAKARADFPQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSDIAGKEQVESFDAFIEVAGKHSAEVIIKMLGKL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.622 kDa

MKVGIIGAMEQEVALLRSQMNEPTTLQLGGCEFYQGKLAGKEVILTRSGIGKVAASVATSLLLEKFAPDCVINTGSAGGFAQDLHIGDMVIADEMRFHDVDVTAFGYEMGQMAQQPAAFPCDGKLIAVAQDCIAEQGKHQTKVGLICTGDQFMCKPDAIAKARADFPQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSDIAGKEQVESFDAFIEVAGQHSAEMIIKMLGKL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.085 kDa

MKIGIIGAMEPEVAHLIASLENPVVSQIAGIEFTQGELNGKQVIVTRSGIGKVAAALATTLLIDKFAPDYVINTGSAGGFVDSLTIGDVVIGSEVRYHDVDVTAFGYEIGQMAQQPAAFVCDAHLVEAAKNAVAKLGEVKTVAGLICTGDSFICDPVRTAKMQADFPTMAACEMEGAAIGQVCHQFATPFVVIRSLSDNANNDSPVDFESYLVKAGHHSALMVMALIEGL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.183 kDa

MKIGIIGAMEPEVAHLIQSLTSAEHSLIAGIEFISGQIAGKDVVITRSGIGKVAASIATTLLIEKFAVTQVVNTGSAGGFVDSLKIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDAALVEAAKKAVSALGEVKAIEGLICTGDSFICDPERTKVMRANFPTMAACEMEGAAIAQVCHQFKVPFVVIRSLSDNANNDSPVDFDSYIIKAGHHSAMMVVALLTEL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.186 kDa

MKIGIIGAMEPEVVHLVQAIVDPVHTTIAGIEFISGSIAGKDVVVTRSGIGKVAASIATTLLIEKFAATHVINTGSAGGFVDSLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDSTLVNAAKSAVAELGEVKAIEGLICTGDSFICDPVRTKVMRENFPTMAACEMEGAAIAQVCHQFNVPFVVIRSLSDNANNDSPVDFDSYIIKAGMHSAMMVIALLQQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.128 kDa

MKIGIIGAMEPEVAHLVESMENPSSTTIAGIEFVAGQLAGKDVIVTRSGIGKVTASIATTLLIEKYAPDVIINTGSAGGFADELAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDAKLVAAAQKAVASLGEVKAIEGLICTGDSFICDPVRTKTMLENFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDEYIVKAGHHSALMVIALLKQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.466 kDa

MKIGIIGAMEPEVAHLIASMTDTQTQTIAGIEFVAGQLEGKEVIVTRSGIGKVTASVATTLLIEKYAPDYVINTGSAGGFVDSLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDRTLVEAAKKAVADLGEVKAIEGLICTGDSFICDPERTKVMLNNFPTMAACEMEGAAIAQVCHQFKVPFVVIRSLSDNANNDSPVDFDSYLVKAGHHSALMVISLLKHL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.173 kDa

MKIGIIGAMEPEVAHLVESMEKPSSTTIAGIEFVAGQLAGKEVIVTRSGIGKVTASIATTLLIEKYAPDAIINTGSAGGFADDLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDAKLVAAAQKAVASLGEVKAIEGLICTGDSFICDPVRTKTMLENFPTMAACEMEGAAIAQVCHQFDVPFVVIRSLSDNANNDSPVDFDEYIVKAGHHSALMVIALLEQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.097 kDa

MKIGIIGAMEPEVAHLVESMENSTSTTIAGIEFVAGQLAGQEVIVTRSGIGKVTASIATTLLIEKYAPDAIINTGSAGGFADDLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFLPDAKLVAAAQKAVASLGEVKAIEGLICTGDSFICDPVRTKTMLENFPTMAACEMEAAAIAQVCHQFAVPFVVIRSLSDNANDDSAVDFDEYIIKAGLHSALMVIALIKQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.171 kDa

MKIGIIGAMEPEVAHLVESMENPSSTTIAGIEFVAGQLAGKDVVVTRSGIGKVTASIATTLLIEKYAPDAIINTGSAGGFADELAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDTALVTAAQKAVASLGEVKAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFDVPFVVIRSLSDNANNDSPVDFDEYLVKAGHHSALMVIALLEQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.217 kDa

MKVGIIGAMEPEVAHLIASMDNAESQTIAGIEFVAGTLDGKEVIVTRSGIGKVAASIATTLLIEKYTPDAVINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDEKLKAAANKAVASLGEVKAIEGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFAVPFVVIRSLSDNANNDSPVDFDSYIVKAGHHSALMVMSLLKHL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.734 kDa

MKIAVIGAMEEEVELLRASLNNAQRTTIAGSEYTTGTYEGKEVVLLKSGIGKVNAAMSTTILLHEFKPDVVINTGSAGGYDEALEVGAVVISDEVRHHDVDVTIFGYEIGQMAGMPAAYKSDERLMKVAEEAVKAVGEHQYGIGLICSGDAFMNDPERVEAVRHHFPQMKAVEMEAAAVAQVCYQFATPFVVIRALSDIAGKESNISFDEFLPVAAKHSTQVVLKAIASL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

230 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.895 kDa

MKIGIIGAMEPEVAILREQISNMETLSIAGCEFYRGELAGHDVILTRSGIGKVAASIATTILLDRYAPDCVINTGSAGGFDPELRVGDVVISDEVRHHDVNVTAFGYEPGQLPQQPAAFISDSKLIEVATQVMHQLPELQSRIGLICTGDQFMCDPDHIEQVRQTFPAMMAAEMEAAAIAQVCHQFKVPFVVIRSLSDIAGTESPSTFEEYLEVAAKNSSAMIVAMLKQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.698 kDa

MIIGVIGAMEQEVMLLSKQLAKLNIWQQARCNIYSGWLHGKKVVLVQSGIGKVSAALGCTLLLTNFEATLVINIGSAGGLSPALAVGDIIVSEEVQYHDVNVTAFGYDKGQMAQYPLLFPASPSLVALTKQLTEHTNINVVCGQIISGDIFINGGQELYKLKRRFPQAIAVDMEVTAIAQICYLFAVPFVGIRVITDIADSVSHKSFKDNLITVVSHLSLLVSDIIQAL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.087 kDa

MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVVLLQSGIGKVAAAIGTTALLQLAKPDLVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASISFEEFLPLAAKQSSALVLEMIDRL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.055 kDa

MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKITQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEFLPLAAKQSSTLVLGMIDRL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

23.965 kDa

MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDCVINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSVKRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEFLPLAAKQSSALVLGMIDRL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

23.954 kDa

MKVGIVGAMAQEVEILASLIENKNVVHIAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKGQLPACPPAFISDPKLTALVANVAKQQGINLTSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASMSFEEFLPLAAKQSSSMVLKILQSL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.023 kDa

MKVGIVGAMAQEVEILASLIENKNVVHIAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDIVINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKGQLPACPPAFISDPKLTALVENVAEQQGINLTSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASISFEEFLPLAARQSSSMVLKILQSL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

23.702 kDa

MKIGIVGAMKQEVEILANLMRNQTVTQVAGCTIYEGLINGKQVALLQSGIGKVAAAIGTTALLQLAKPDVVLNTGSAGGVADGLKVGDIVISTETAYHDADVTAFGYAKGQLPACPATFISDEKLTALAKQVAQAQGHNVKRGLICSGDSFIAGGERLAQIKADFPNVTAVEMEAAAIAQVCHVFRVPFVVVRAISDAGDGQAGMSFEEFLPIAAKQSSAMIIGMLEQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

25.035 kDa

MTIGIIGAMDEEIALLKQQMKDMEELEVAGCYFYTGHLHDKSVVLLLSGIGKVNAAMATTILHERFSPSMIINTGSAGGFASDLQVGDVVISEEVLHHDVDATAFDYVYGQVPGMPATYKADQRLVELSSEVMKDIEINSRIGVIATGDSFMQRKDQTDIVKQRFPGMLALEMEAASIAQVCYRYNTPFVITRALSDIAGQESSVSFDQFLQTAGKNAAQLIINMVKKI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

229 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.065 kDa

MKIGIVGAMAQEVQMLADLMQDKRVTQVASCTIYEGMIHGKAVALLQSGIGKVAAAIGATLLLEMCKPDLVINTGSAGGVATGLNVGDIVISDETVYHDADVTAFGYAKGQLPACPARFQSDEKLVQLAEKIAVQQQQQVKRGLICSGDSFIQGGTPLAQIKADFPTVMAVEMEATAIAQVCHAFNVPFVVVRAISDSGDGEASMSFEEFLPLAAKQSSAMVLEMIDNL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.53 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDIIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEISFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDIIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQVPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.534 kDa

MIGIIGAMEEEILILKEKITDLEEISIAHVKFYKGYIDNQEVVLTLSGIGKVNAAISTTLLINTFSPDVILNTGSAGALDHSLNIGDVLISTEATYHDADATAFGYELGQIPNMPIAYAADDDLVTLAQSVVEQQEMNGKLGLIVSGDSFIGEVSQRETIKTNFPDAMAVEMEATAIAQTCYQFKVPFIITRAVSDLANGEANMTFDEFIGEAAKSSSEIVLEMLKSL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.944 kDa

MIGIIGAMEEEVTILKRKLNDMNEINIAHVKFYVGKLNHKEVVLTQSGIGKVNASISTTLLIEKFNPEVVINTGSAGALDQTLSIGDILVSNHVLYHDANATAFGYEYGQIPQMPKTYTTDPTLLKKTMHVLEQQQLNGKVGMIVSGDSFIGSSEQRQKIKQQFPEAMAVEMEATAIAQTCYQFKVPFIVTRAVSDLANGKADISFEEFLDKAALSSSETVSLLVESL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.944 kDa

MIGIIGAMEEEVTILKRKLNDMNEINIAHVKFYVGKLNHKEVVLTQSGIGKVNASISTTLLIEKFNPEVVINTGSAGALDQTLSIGDILVSNHVLYHDANATAFGYEYGQIPQMPKTYTTDPTLLKKTMHVLEQQQLNGKVGMIVSGDSFIGSSEQRQKIKQQFPEAMAVEMEATAIAQTCYQFKVPFIVTRAVSDLANGKADISFEEFLDKAALSSSETVSLLVESL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.754 kDa

MIGIIGAMEEEVAILKDKLTDMNEISVAHVKFYRGKLNSKEVVLTQSGIGKVNAAISTTLIIEKFNPKLIINTGSAGALDESLSVGDMLISNDVVYHDVDATAFGYKLGQIPQMPLEFKSDQELLKSVETVINKKNYNAKIGQIVSGDSFIGSVDQRLTIKRQFPEAMAVEMEATAIAQTCHQFHVPFIVTRAVSDLANGKADISFEEFLGEAAKSSSSIVESLIKVL

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

228 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.586 kDa

MIGIIGAMEEEVAILKDKIVNLEIINVAHVVFYKGRLHDKEVILTQSGIGKVNVAISTTLLINRFHPDLIINTGSAGALDKSLGVGDIIVSDMVAYHDADARAFGYQLGQIPQMPAQFVADSHLIELAKEAINDQKWVAKSGLIVSGDSFIGTAEQRADIKTNFPQAMAAEMEATAIAQTCYQFNLPFIITRAISDLADGDAGITFEAFLEKAAIASSQIVDRLIKTI

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

217 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

24.166 kDa

MILVLGVFKIEVEPMLKEMEVLEKGRLLKRYYQRGVVGRNEVVVSYGFIGKVEAALVTQAFLDRFNIDAVFLTGNAGGLEGVEVGDVVIGDSYVEYDFETALGDEGIIVSGSEDLEDKVIAYSNREIKTGLIASGDAFVTVKEKAEEIKRRTGALCVDMDSAAVAKVCYENEKKFLAIKTIVDICGRETEEEFRKNYERYGFLSNLILLDVLKKCVF

mtnN

5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

35 amino acids

Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively.

Belongs to the PNP/UDP phosphorylase family. MtnN subfamily.

3.924 kDa

single

MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYT