About Products Protein Database Contact

mrpl8

Gene
MRPL8
Protein
54S ribosomal protein L8, mitochondrial
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
238 amino acids
Function
Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane.
Similarity
Belongs to the bacterial ribosomal protein bL17 family.
Mass
26.945 kDa
Sequence
MTVGIARKLSRDKAHRDALLKNLACQLFQHESIVSTHAKCKEASRVAERIITWTKRAITTSNSVAQAELKSQIQSQLFLAGDNRKLMKRLFSEIAPRYLERPGGYTRVLRLEPRANDSAPQSVLELVDSPVMSESHTVNRGNLKMWLLVKSVINDDANQLPHNPLTLQNLHKVAKFKAEAQLHGEIMLIKQVLLKEMSLPYDEALENERTQALLKEVYSSSLPKKTKKPSSYVMVPRP

Gene
mrpl8
Protein
54S ribosomal protein L8, mitochondrial
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
207 amino acids
Similarity
Belongs to the bacterial ribosomal protein bL17 family.
Mass
23.967 kDa
Sequence
MTKTLYYRKLGRTSAHRQALLRNLVTSLVKHESIQTTWAKAKEAQRFAEKLITMAKRANPQNNRKGLAEGMVFEKETTLKKVFDVLVPRYNGRRCGYTRLLKLPPRSTDNAPMGVLEFVDGPKDIRFHMTAKTVGICLAQQKALTPITRKNIHKVLLFRKNGKAEFDQLVQKEKESEHARLKEDHEDEKTVKKDWKRGDPIPRPTYI