mprB

Signal transduction histidine-protein kinase/phosphatase MprB

522 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

56.175 kDa

MIRLHRPQRPPLRAPLRATPSLSLRWRVMLLAMSMVAMVVVLMAFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGHAIYTAQQPGQTLPVGSPEKAVIHGELFMSRRTAGDQRILAVHLQNGTSLLISKSLKPTEAVMNKLRWVLLIVGGVGVAVAAVAGGMVTRAGLRPVARLTEAAERVARTDDLRPIPVFGSDELARLTESFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMEPGAPRLPEQEMVELRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPVDMSDVIDRSLERVRRRRNDIHFDVDVTPWQMYGDAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQLDPSHAELVVSDHGPGIPPQERRLVFERFYRSTSARAMPGSGLGLAIVKKVVLNHGGMLRVEDTVPGGQPPGTSFYVLLPGRPLPPAGHSTPAGESETDKAEAATDPAVPVAGDTANSRESANVISVDSQSARAR

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

522 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

56.219 kDa

MIRLYRPQRPPLRAPLRATPSLSLRWRVMLLAMSMVAMVVVLMAFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGHAIYTAQQPGQTLPVGSPEKAVIHGELFMSRRTAGDQRILAVHLQNGTSLLISKSLKPTEAVMNKLRWVLLIVGGVGVAVAAVAGGMVTRAGLRPVARLTEAAERVARTDDLRPIPVFGSDELARLTESFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMEPGAPRLPEQEMVELRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPVDMSDVIDRSLERVRRRRNDIHFDVDVTPWQMYGDAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQLDPSHVELVVSDHGPGIPPQERRLVFERFYRSTSARAMPGSGLGLAIVKKVVLNHGGMLRVEDTVPGGQPPGTSFYVLLPGRSLPPAGHSTPAGESETDQAEAATDPAVPVAGDTANSRESANVISVDSQSARAR

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

519 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

56.471 kDa

MVRFAWRRRASLRATSSLSLRWRVMLLAMSMVAMVVVLMAFAVYVVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGHSIYTANQPGQTLPVGTAEKAVIRGELFMSQRTASDQRILAIHLPNDSSLLISKSLRPTEAVMTKLRWVLLIVGSLGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLIASMAPEAPRLPDQEMADLRADVLAQIEELSTLVGDLVDLTRDDAGQVVHEPIDMSEVLYRSLERVRRRRNDIHFDVQAIGWQIYGDAAGLSRAVLNLMDNAAKWSPSGGRVVVTMRQFDPSHVELVVSDYGPGIPPQERRLVFERFYRSTTARSLPGSGLGLAIVKQVVINHGGLLRVEDTAPGVQPPGTSIYVLLPGRPMPVSAYSTLADQDMGEANFQDKIGPAVQVSGKSANFRDSAHVISVDYQSARAR

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

515 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

55.042 kDa

MTLPPQPSRLKPPRNTSSLSLRWRVMLLAMSMVAMVVVLMSVAVYAVVSRALYDDIDNQLHSRARLLIESGSLAADPGKAIEGTAYSDVNAMLVNPGRSIYTANQQGQTLPLGEAEKDVISGELLLSLRTANHQRILAVHLTNGSSLLISKSLAPTGQVLGRLGTVLLIVGGVGVAVAAIAGGMVARAGLRPVGRLTQAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRERQARLVSDAGHELRTPLTSLRTNVELLMASQAPGAPRLPEEEMAGLRADVIAQIEELSTLVGDLVDLTRDEAGGVVYETVDMAEVVDRSLERVRRRRNDIEFDVNVVGWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAARAMPGSGLGLAIVKQVVLKHGGALRVEDTVPGGNPPGTSFYVMLPGRPLTPGGNGTAPVPAAQFDPDMRSAGSRADRRVIKNTETNGKSRSASKEL

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

515 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

55.011 kDa

MTLPPPPSRLKPPRNTSSLSLRWRVMLLAMSMVAMVVVLMSVAVYAVVSRALYDDIDNQLHSRARLLIESGSLAADPGKAIEGTAYSDVNAMLVNPGRSIYTANQQGQTLPLGEAEKDVISGELLLSLRTANHQRILAVHLTNGSSLLISKSLAPTGQVLGRLGTVLLIVGGVGVAVAAIAGGMVARAGLRPVGRLTQAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRERQARLVSDAGHELRTPLTSLRTNVELLMASQAPGAPRLPEEEMAGLRADVIAQIEELSTLVGDLVDLTRDEAGGVVYETVDMAEVVDRSLERVRRRRNDIEFDVNVVGWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAARAMPGSGLGLAIVKQVVLKHGGALRVEDTVPGGNPPGTSFYVMLPGRPLTPGGNGTAPVPAAQFDPDMRSAGSRADRRVIKNTETNGKSRSASKEL

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

515 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

55.011 kDa

MTLPPPPSRLKPPRNTSSLSLRWRVMLLAMSMVAMVVVLMSVAVYAVVSRALYDDIDNQLHSRARLLIESGSLAADPGKAIEGTAYSDVNAMLVNPGRSIYTANQQGQTLPLGEAEKDVISGELLLSLRTANHQRILAVHLTNGSSLLISKSLAPTGQVLGRLGTVLLIVGGVGVAVAAIAGGMVARAGLRPVGRLTQAAERVARTDDLRPIPVFGSDELARLTEAFNMMLRALTESRERQARLVSDAGHELRTPLTSLRTNVELLMASQAPGAPRLPEEEMAGLRADVIAQIEELSTLVGDLVDLTRDEAGGVVYETVDMAEVVDRSLERVRRRRNDIEFDVNVVGWQVYGDAAGLARAVLNLLDNAAKWSPPGGRVGVRLTQTDPVHAELVVSDQGPGIPEAERRLVFERFYRSTAARAMPGSGLGLAIVKQVVLKHGGALRVEDTVPGGNPPGTSFYVMLPGRPLTPGGNGTAPVPAAQFDPDMRSAGSRADRRVIKNTETNGKSRSASKEL

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

511 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

54.585 kDa

MVGFRRGPRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGRSIYTANQPGQTLPVGAPEKAVIHGDLFLSRRTVSDQRVLAIHLPNGSSLLISKSLKPTEAVMTKLRAVLLIVGGVGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVSDAGHELRTPLTSLRTNVELLMASMEPGAPRLPEQEMVGLREDVVAQIEELSTLVGDLVDLTRGDAGVVVHEPVDMAEVVDRSLERVRRRRNDIHFDVDVVGWQVYGDAAGLSRAALNLMDNAAKWSPPGGRVGIRLRQLDPSHAELVVSDNGPGISPQERRLVFERFYRSTSARAMPGSGLGLAIVKQVVLNHGGSLRIEDTVPGGQPPGTAICMLLPGRPMPDSAYPAAPDDKKTEPVDTRGANGANSRGSANVISVDSQSARAR

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

504 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity). MprB/MprA up-regulates expression of mprA and pepD.

54.432 kDa

MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQRVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMAPGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRRNDIHFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIPVQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPIPQLPGATAGARSTDIENSRGSANVISVESQSTRAT

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

504 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

54.432 kDa

MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQRVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMAPGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRRNDIHFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIPVQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPIPQLPGATAGARSTDIENSRGSANVISVESQSTRAT

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

504 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

54.408 kDa

MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQRVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMAPGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRRNDILFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIPVQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPIPQLPGATAGARSTDIENSRGSANVISVESQSTRAT

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

504 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA. MprB/MprA is involved in regulation of numerous stress-responsive genes (By similarity).

54.408 kDa

MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQRVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMAPGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRRNDILFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIPVQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPIPQLPGATAGARSTDIENSRGSANVISVESQSTRAT

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

504 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA. MprB/MprA is involved in regulation of numerous stress-responsive genes, including up-regulation of two sigma factors, sigE and sigB as well as pepD and mprA, and repression of multiple genes from regulons associated with hypoxia, starvation and iron metabolism. The majority of genes regulated by MprB/MprA under a particular stress condition are different from those induced during normal growth, but several genes are commonly regulated under more than one condition.

54.408 kDa

MWWFRRRDRAPLRATSSLSLRWRVMLLAMSMVAMVVVLMSFAVYAVISAALYSDIDNQLQSRAQLLIASGSLAADPGKAIEGTAYSDVNAMLVNPGQSIYTAQQPGQTLPVGAAEKAVIRGELFMSRRTTADQRVLAIRLTNGSSLLISKSLKPTEAVMNKLRWVLLIVGGIGVAVAAVAGGMVTRAGLRPVGRLTEAAERVARTDDLRPIPVFGSDELARLTEAFNLMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMASMAPGAPRLPKQEMVDLRADVLAQIEELSTLVGDLVDLSRGDAGEVVHEPVDMADVVDRSLERVRRRRNDILFDVEVIGWQVYGDTAGLSRMALNLMDNAAKWSPPGGHVGVRLSQLDASHAELVVSDRGPGIPVQERRLVFERFYRSASARALPGSGLGLAIVKQVVLNHGGLLRIEDTDPGGQPPGTSIYVLLPGRRMPIPQLPGATAGARSTDIENSRGSANVISVESQSTRAT

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

492 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

52.579 kDa

MAFPPNSWRPTGPLPTSSLSLRWRVMMLAMSMVALVVVLMAVAVYAVVSRALYDDLDNQLHSRARLLIESGSLAADPGKAIEGTAYSDVNAMLVIPGRSIYTANQQGQTLPLGEPEKDVISGELLMSLRTANHQRVLAVHLANGSSLLISKSLAPTVQVLRRLGTVLLIVGGIGVAVAAIAGGAVARAGLRPVGRLTEAAERVARTDDLRPIPVVGSDELARLTEAFNMMLRALAESRERQARLVSDAGHELRTPLTSLRTNVELLMAAQEPGAPPLPEDEMAGLRADVIAQIEELSTLVGDLVDLTREDAGGITPEPVDMADVIDRSLERVRRRRNDIEFDVDVIGWQVFGDAQGLGRAVLNLLDNAAKWSPPGGRVGVRLHQVDHMHAEIVVSDQGPGIPPEERRLVFERFYRSDAARAMPGSGLGLAIVQQVVLKHGGALRIDETVPGGNPPGASVHMLLPGQRIPDPGATRSAEGFVDDRGGHTVATE

mprB

Signal transduction histidine-protein kinase/phosphatase MprB

484 amino acids

Member of the two-component regulatory system MprB/MprA which contributes to maintaining a balance among several systems involved in stress resistance and is required for establishment and maintenance of persistent infection in the host. In response to environmental signals MprB acts as both a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to MprA, and a protein phosphatase that dephosphorylates phospho-MprA (By similarity).

51.961 kDa

MAADNAGRWPGQPPGPPAPTHPASSVSLRWRVMLLAMSMVVISVVLMAVAVFAVTSRALYDDIDNQLRSRAQMLIESRSLDIDPGKAIEGTAYSDMNAMFYIPGRSKYTANQQGQTLPVGQPEQDVMDGTLLLSLRTVEHQRVLAIRLASGNTLLLSKSLAPTGKVLKRLGTVLLIVGGLGVAVAAIAGGMVASAGLRPVGRLTQAAERVARTDDLRPIPVIGNDELARLTETFNMMLRALAESRERQARLVTDAGHELRTPLTSLRTNVELLMESMKPGAPRIPEEDMAELRTDVIAQIEEMSTLVGDLVDLTRDDAGNAVHETVEITEVIDRSLERVRRRRNDIQFDVAVTPWQVYGDAAGLGRAVLNLLDNAAKWSPPGGRVGVGLTQIDALHAELVVSDRGPGIPPQERALVFERFFRSTSARSMPGSGLGLAIVKQVVLKHGGTLRIEDTVPGGTPPGTAMHVVLPGRPSPAGSDEAER