motB

Motility protein B

309 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

34.159 kDa

MKNQAHPIVVVKRRRHKPHGGGAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAEYFRTPLATAVTGGNRIANSESPIPGGGDDYTQQQGEVEKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQAEQAILHENAESQNEPVSVLQQPAAAPPASVPTSPKAEPR

motB

Motility protein B

308 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

34.186 kDa

MKNQAHPIIVVKRRKAKSHGAAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAEYFRTPLATAVTGGDRISNSESPIPGGGDDYTQSQGEVNKQPNIEELKKRMEQSRLRKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFRTGSADVEPYMRDILRAIAPVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVGMAATMRLSDRGPDDAVNRRISLLVLNKQAEQAILHENAESQNEPVSALEKPEVAPQVSVPTMPSAEPR

motB

Motility protein B

308 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Probably a linker that fastens the torque-generating machinery to the cell wall. Overexpression of this protein with MotA improves motility in a pdeH disruption, (a c-di-GMP phosphodiesterase) suggesting there is an interaction (direct or indirect) between the c-di-GMP-binding flagellar brake protein YcgR and the flagellar stator.

Belongs to the MotB family.

34.186 kDa

MKNQAHPIIVVKRRKAKSHGAAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAEYFRTPLATAVTGGDRISNSESPIPGGGDDYTQSQGEVNKQPNIEELKKRMEQSRLRKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFRTGSADVEPYMRDILRAIAPVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVGMAATMRLSDRGPDDAVNRRISLLVLNKQAEQAILHENAESQNEPVSALEKPEVAPQVSVPTMPSAEPR

motB

Motility protein B

261 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

29.483 kDa

MARKKKKKHEDEHVDESWLVPYADILTLLLALFIVLYASSSIDAAKFQMLSKSFNEVFTGGTGVLDYSSVTPPENESDGIDEVKKEKEEKEKNKKEKEKAADQEELENVKSQVEKFIKDKKLEHQLETKMTSEGLLITIKDSIFFDSGKATIRKEDVPLAKEISNLLVINPPRNIIISGHTDNMPIKNSEFQSNWHLSVMRAVNFMGLLIENPKLDAKVFSAKGYGEYKPVASNKTAEGRSKNRRVEVLILPRGAAETNEK

motB

Motility protein B

257 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

28.838 kDa

MAKKNKPTECPAGEKWAVPYADFLSLLLALFIALYAISAVNKSKVEALKTEFIKIFNYAPKPEAMQPVVVIPPDSGKEEEQMASESSKPASQNTETKATIARKGEGSVLEQIDQGSVLKLPSSLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDNTPLNKTRFKSHYELAANRAYRVMKVLIQYGVDPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDEEFNPHKQQE

motB

Motility protein B

257 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

28.849 kDa

MAKKNKPTECPAGEKWAVPYADFLSLLLALFIALYAISAVNKSKVEALKTEFIKIFNYAPKPEAMQPVVVIPPDSGKEEEQMASESSKPASQNTETKATIARKGEGSVLEQIDQGSILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNPHKQQE

motB

Motility protein B

238 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall (By similarity).

Belongs to the MotB family.

26.05 kDa

MARKRRAPRGAAQGWLTTYSDMVTLMLCFFVMLFNPTEVDITVLQSIAASIVGDPTGGGVSASSGRLADLGNTVNTLPSLEKGQKLATALKKAVSLFAPEIKSNKIAVTSDERGLVISLTSDSFFYPGSSDLNVEESREALLRVAQFLSDHALAGRRFRIEGHTDSVEVPEDGSTDNWELSTRRAVRVLHYLTDFGAQENRFSLAGYADTRAKFSNESPEGRAYNRRVDIVILDEGHF

motB

Transcription regulatory protein motB

162 amino acids

Plays a role in the transcriptional regulation of middle promoters.

18.217 kDa

MIINIGELARVSDKSRSKAAGKLVEVVSIQLKHGVKDEDSEVKVRIIPKDGKSKPQFGYVRAKFLESAFLKAVPAKGIETIDTSHVGVDFKWKLGQAIKFIAPCEFNFIKDDGRVVYTRAMCGYITDQWVEDGVKLYNVVFLGTYKVIPESWIKHYSNALYA