motA

Motility protein A

295 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel. Overexpression of MotA, with or without MotB, restores motility in a pdeH disruption, (a c-di-GMP phosphodiesterase) suggesting there is an interaction (direct or indirect) between the c-di-GMP-binding flagellar brake protein YcgR and the flagellar stator.

Belongs to the MotA family.

32.011 kDa

MLILLGYLVVLGTVFGGYLMTGGSLGALYQPAELVIIAGAGIGSFIVGNNGKAIKGTLKALPLLFRRSKYTKAMYMDLLALLYRLMAKSRQMGMFSLERDIENPRESEIFASYPRILADSVMLDFIVDYLRLIISGHMNTFEIEALMDEEIETHESEAEVPANSLALVGDSLPAFGIVAAVMGVVHALGSADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETSKMMQCVKVTLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVKNPQQQTTTEEA

motA

Motility protein A

295 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

32.082 kDa

MLILLGYLVVIGTVFGGYVMTGGHLGALYQPAELVIIGGAGIGAFIVGNNGKAIKGTMKAIPLLFRRSKYTKSMYMDLLALLYRLMAKSRQQGMFSLERDIENPKESEIFASYPRILADAVMLDFIVDYLRLIISGNMNTFEIEALMDEEIETHESEAEVPANSLAMVGDSLPAFGIVAAVMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLATVLRQKSAETTKMMQCVKITLLSNLNGYAPPIAVEFGRKTLYSSERPSFIELEEHVRAVRNPNQQQTTEEA

motA

Motility protein A

292 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

31.577 kDa

MNIIIGLLVTFGCILGGYMAMGGHLEVLNQPFELMIIGGAGIGGFIMANSMKVVKDTGKALGEAFRHKVPKEREYLDTLGVLYSLMRDLRTKSRNEIESHIDNPEESSIFQSAPTVLQNKELTAFICDYVRLIIIGNARSHEIEALMDEEIQTITHDKMKCYHAMTTMGDALPAIGIVAAVLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGPLVANIKSVREKQNRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMMNPGGGSESKAA

motA

Motility protein A

290 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

31.529 kDa

MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGFIMANPMKVVKDSGKALGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNKELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAAVLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYIIVKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA

motA

Motility protein A

270 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

29.339 kDa

MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVPTLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQSAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELGHAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQKLLMYLPAKDRLKFAEQGEAQNGEKKEEEA

motA

Motility protein A

260 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

28.354 kDa

MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSFSALMASSEVVAVKKIPTYLGFFFRRNSYAKVSIIKILVELSEKARKEGLLSLDDELEQINDPFFKSGMRLVVDGADPEVIRTMLYLELDQMQERHKVGSDLFKTWAKLAPAFGMTGTLIGLVALLGNLEDKSALGSSMAVALITTLYGTIMANLMFTPVQLKLEKIDTEEAAVKTMIIEGVLSIQSGDNPRILEQKLMTFLTPKDRSQLNSSIGGE

motA

Motility protein A

259 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

28.645 kDa

MDIASFIGLFGGFAIIIFGAVLGGSARGLFHVPSLLITVGGSYLTLFLTYPLSYAVGVFRVIARVFHAADFHEREIVQRLYALAEKSRRTGLLALEEEIQDFDDDFVRTGLRNVVDGVDGDAIKALMESELTHMEDRHNTWISLLNSWAALAPGYGMLGTVMGLIGMLATLEDKSSLGSNMATALITTFYGSLVQNWFITPVATKLQYQHDLEVKSKEMVIEGVLSIQAGDHPRVLAQRLLTYLSPKMRKELEMELIKD

motA

Motility protein A

259 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

28.739 kDa

MDLASFIGFFGAFAIILMGGILGGSASGFFHLPSVFITVGGSYLTLFLAYPLSYTLGIFKVCARVFKSADFHEKEIVQRLYALAEKSRRTGLLALEEEIQDFDDEFMRTGLRNVVDGIDGEAIRNLMENELSHMEERHNRWISFINAWATLAPGYGMLGTVMGLIGMLMALEDKSSLGQNMAVALVTTLYGSLMANWLLIPMATKLGLQHEAEVKSKEMIIEGVLAIQAGDHPRILAQRLLVYLNPKDKRELEAELIKD

motA

Motility protein A

257 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

27.71 kDa

MDLSTILGLVLAVASISLGDILEDGNPLHIIHLSSVIIIVPTSLFAAMTGTHARYVKAAYKEIKIVFLNPKINLNETIKNLVELATLARKDGVLSLEGRVAQIEDDFTRNGLSMIIDGKDLKSVKESLEISIEEMEEYYHGAAHYWETAGETAPTMGLVGAVMGLMLALQKLDNPAEMAAGIAGAFTATVTGIMCSYAIFGPFGHKLKAKSKDIIKEKTVLLEGILGIANGENPRDLENKLLNYIAPGEPKKSQFEG

motA

Motility protein A

257 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

27.71 kDa

MDLSTILGLVLAVASISLGDILEDGNPLHIIHLSSVIIIVPTSLFAAMTGTHARYVKAAYKEIKIVFLNPKINLNETIKNLVELATLARKDGVLSLEGRVAQIEDDFTRNGLSMIIDGKDLKSVKESLEISIEEMEEYYHGAAHYWETAGETAPTMGLVGAVMGLMLALQKLDNPAEMAAGIAGAFTATVTGIMCSYAIFGPFGHKLKAKSKDIIKEKTVLLEGILGIANGENPRDLENKLLNYIAPGEPKKSQFEG

motA

Motility protein A

254 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

27.263 kDa

MDVGTIIGIIAAFLLILISILIGGSITAFINVPSIFIVVGGGMAAAMGAFPLKDFIRGVLAIKKAFLWKPPDLNDVIETIGEIASKVRKEGILALEGDIELYYQKDPLLGDMIRMLVDGIDINDIKATAEMALAQLDEKMSTEVAVWEKLADLFPAFGMIGTLIGLIQMLRNLNDPSALGPGMAVALITTLYGAILANAFAIPVANKLKKAKDMEVLVKTIYIEAIEKIQKGENPNVVKQEAAIMLGVELPEEV

motA

Motility protein A

253 amino acids

MotA and MotB comprise the stator element of the flagellar motor complex. Required for rotation of the flagellar motor. Probable transmembrane proton channel (By similarity).

Belongs to the MotA family.

27.195 kDa

MDIAAAIGLIGAIVMVVGSMIYAGGVAPFVDIPSLVIVVAGTAFIVLAMKPLPVFLGHFKAMMKVFKPSRFDMNEVISTMVELSNLARKDGIMALEGKAVPDAFFEKGLQLLVDGTDEAKLVKQLKYEIKAMKARHEAYQGAVKAWIDIGPAMGMVGTLIGLVLMLGNMSDPKSIGPAMAVALLTTLYGALMANVIFAPILNKLEGYSADEVTYRELVIEGLRGIARGESARMIEDQMVCALDRKQQMKRKAA

motA

Middle transcription regulatory protein motA

211 amino acids

Required for the transcriptional activation of middle promoters. Middle promoters are characterized by the presence of the conserved sequence [AT]3TGCTTNA (MotA box). MotA binds directly to MotA boxes.

23.574 kDa

MSKVTYIIKASNDVLNEKTATILITIAKKDFITAAEVREVHPDLGNAVVNSNIGVLIKKGLVEKSGDGLIITGEAQDIISNAATLYAQENAPELLKKRATRKAREITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL