mobB

Probable mobile endonuclease B

264 amino acids

To phage T4 mobC and mobD.

30.363 kDa

MNYLNIYNLLIEKGLNRGNDKSLLTYYTETHHIIPRCMGGTDDKTNLVLLTPEEHFTAHLLLFKIYRLPKLALAIRMMCYSSDGTRLNNKMYGWIKTAVSSSISESMKEFWKDDDNKKYMSNARRNAGKPIYQYDLNGNFIRKYRCITDAAEDMSYSCSTSIKQCVDGKRKTAGGFQWKYYYSDNIGKPSRMSNATKQKMSKSKRGITQKRNVPVFQYDTTGKLLRVFPRIKDAAVSVKGCMSNIKKCISGKSKIAYGYVWAYS

mobB

Putative molybdopterin-guanine dinucleotide biosynthesis adapter protein

234 amino acids

GTP-binding protein that is not required for the biosynthesis of Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor, and not necessary for the formation of active molybdoenzymes using this form of molybdenum cofactor. May act as an adapter protein to achieve the efficient biosynthesis and utilization of MGD. Displays a weak intrinsic GTPase activity (By similarity).

Belongs to the MobB family.

26.08 kDa

MRVIGVIGYKDSGKTTLIEEILKHSDKKIAVIKHTKEDVEVDKKGTDTYRLSNAGAKITVLATDSKTVFFTDRMDLENILSVLSDYNIDFVIIEGFKEALKRLNIPKIVMLKDKDGSDLIDDHTAMIIEDYNYNIDDVLKVIYEKAVVPTMNLNCGHCGYNCRTFVKAVVKGEARWDDCVLAKGIKIIVDGKIIPAVPFVSKIVGSTIKAMIETLKGVDNPKTIKVEIDVSKLK

mobB

MOB kinase activator-like 1 homolog B

216 amino acids

Belongs to the MOB1/phocein family.

25.109 kDa

MFKIFNSDKNKTFKPKKGFSKGTKRHDLHKHAKATLGSGNLRLAVSLPEREDLNEWLAVNTVDFFNQINLLYGSITEFCTPKTCEVMSAGPKYEYLWADGESVKKPIKVSAPEYVEFLMTWVQGILDDENIFPSRVDVQFPKNFQSIVKNIFKRLFRVYGHIYYSHFTKIVSLGEEAHLNTCFKHFYFFIVEFNLVDKKEMLPLQDLIDNLTKSST

mobB

Molybdopterin-guanine dinucleotide biosynthesis adapter protein

178 amino acids

GTP-binding protein that is not required for the biosynthesis of Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor, and not necessary for the formation of active molybdoenzymes using this form of molybdenum cofactor. May act as an adapter protein to achieve the efficient biosynthesis and utilization of MGD. Displays a weak intrinsic GTPase activity (By similarity).

Belongs to the MobB family.

20.532 kDa

MIFKVIFMNNQIPLLGITGYSGSGKTTLLEKLIPELIARHIRVSVIKHSHHNMQVDKEGKDSWRMKEAGSSQVILANDERWAIMTETPKPVSLDYLAQQFDRTLTDLVLVEGFKQEPIPKILLHRQEMTKPLPEIDEYVLAVATNYPLEIDRTLLDINRIPQIADFIENWLHHFHGAR

mobB

Molybdopterin-guanine dinucleotide biosynthesis adapter protein

175 amino acids

GTP-binding protein that is not required for the biosynthesis of Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor, and not necessary for the formation of active molybdoenzymes using this form of molybdenum cofactor. May act as an adapter protein to achieve the efficient biosynthesis and utilization of MGD. Displays a weak intrinsic GTPase activity. Is also able to bind the nucleotides ATP, TTP and GDP, but with lower affinity than GTP.

Belongs to the MobB family.

19.363 kDa

MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG

mobB

Probable molybdopterin-guanine dinucleotide biosynthesis adapter protein

173 amino acids

GTP-binding protein that is not required for the biosynthesis of Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor, and not necessary for the formation of active molybdoenzymes using this form of molybdenum cofactor. May act as an adapter protein to achieve the efficient biosynthesis and utilization of MGD. Displays a weak intrinsic GTPase activity (By similarity).

Belongs to the MobB family.

19.145 kDa

MALVRPFPIVQVVGFQNSGKTTFIERILEKASEQGVHLGCLKHHGHGGEPQTLTEGKDTDRYKAAGADVTAVEGAGVLQLTARRNWDLARLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALQAVNIIAIIYRKKEHMTEHQGLPVFHADDPVAVDFVLSQLKGESA

mobB

Mobilization protein MobB

148 amino acids

This protein is essential to promote the specific transfer of the plasmid in the presence of conjugative plasmids.

15.933 kDa

MILRGCTMALERYNVSQPKRQAERGENTADPALAAGRACSTAELVARRLGIAAVQPVYRFLDTWWRKGCWSGEITRLTAVRSACGADAARGGVLVRRGRAADGHYSVSCRRGVCAQLPRTGWPFELLRLAMEGNSRGAPAGGTCTVLP

mobB

Mobilization protein B

137 amino acids

This protein is essential to promote the specific transfer of the plasmid in the presence of conjugative plasmids.

15.112 kDa

MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQASEAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASMMPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR