Mob1

MOB kinase activator-like 2

562 amino acids

Required for the normal morphogenesis of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites.

Belongs to the MOB1/phocein family.

59.585 kDa

MKETLSSKVPTTRTVGVTFDSVSESKSKLKSGSVQGTTATATATGPPSPPSSYVIKCLLKTARFMWQVTTIPAKIGDTLGTLYRYAQDSVDTFLCVAGKARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDLEVALRLTDDTSGQDSSSSVHEHSSSSSSPPVQHQQHQHQQQHNNSSSTSNSTSPAEALHVNSQSNSNSHSNSSNSHTTTASASASLIDGDSAAPPICTQPEAGAGCKPAGSSGLLGGILGDLTSGEFGDTTRYCTSAVPQAAASSSASAAGPGADGAASAALNNGAGALHLNFSNNNNNNHNLNHLNHHHHHHHHQHHHQHHPHGHHGHQGHQGHQGHHQAPASTTVPHSGLIQCNAAGAVGASAGGGGNAVSAATGGATSASSTA

MOB1

DBF2 kinase activator protein MOB1

314 amino acids

Functions as an activator subunit for the DBF2 protein kinase. Binds to DBF2, which is required for the phosphorylation and activation of DBF2 by the upstream kinase CDC15 in late anaphase. DBF2-MOB1 is part of the mitotic exit network (MEN) signaling cascade, which regulates release from the nucleus and activity of phosphatase CDC14. Required for inactivation of mitotic cyclin-dependent kinase for exit from mitosis, cytokinesis and G1 gene transcription.

Belongs to the MOB1/phocein family.

35.882 kDa

MSFLQNFHISPGQTIRSTRGFKWNTANAANNAGSVSPTKATPHNNTINGNNNNANTINNRADFTNNPVNGYNESDHGRMSPVLTTPKRHAPPPEQLQNVTDFNYTPSHQKPFLQPQAGTTVTTHQDIKQIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPRMIATNEYEYLWAFQKGQPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFPEGFIQRVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPADFGPLLELVMELRDR

mob1

Maintenance of ploidy protein mob1

210 amino acids

Has a role in promoting the onset of septum formation during the latter stages of mitosis.

Belongs to the MOB1/phocein family.

24.744 kDa

MFGFSNKTAKTFRVRKTEAGTKHYQLRQYAEATLGSGSLMEAVKLPKGEDLNEWIAMNTMDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDWTQEKLDDKKLFPTEIGVEFPKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQDLVDSMV