mntB

Manganese transport system membrane protein MntB

306 amino acids

Part of an ATP-driven transport system for manganese.

Belongs to the ABC-3 integral membrane protein family.

33.482 kDa

MNQLVVAFPFWHWLVEPLQYEFLIRAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHAVVPGVVLAYALNIPFAIGAFTFGFGATVAIGYVKSKTRLKEDAVIGIVFTGFFALGLVLVTKIPSNVDLFHILFGNVLGISQQDIIQTLIAGSITLIVILLRRKDLLLFCFDPNHAKAIGLRTQVMYYTLLSVLALTIVAALQTAGIILVISMLVTPGSIGYLLSDRFDHMLWYSVVSSVLSCVLGTYLSYHFDVSTGGMIVVILTTLFVIAMIGAPKYGILAQEWRKRSGPNPEDDENQTVVVDQV

mntB

Manganese transport system ATP-binding protein MntB

250 amino acids

This protein is probably a component of a manganese permease, a binding protein-dependent, ATP-driven transport system. Probably responsible for energy coupling to the transport system (By similarity).

Belongs to the ABC transporter superfamily.

28.395 kDa

MNPVVKVDNLSVFYEQHQAIKNIRFQAGPGQMIGILGPNGAGKSTLMKAILGLERYTGTVKVLDKHVRHVRKQIAYVPQRNAIDWDFPVLVEDVVMMGRFAHIPWFKRAGKNDKRLVEESLKKVGMEEYRSRQIGELSGGQQQRVFIARALAQESELFFLDEPFVGIDVTSESIILSLLQELRDRGKTIFVVHHDLSKVEKYFDQVLMLNKELIAYGPVADVYTPEMVAKTYQGNLATFSKKDEVMVVNV

mntB

Manganese transport system ATP-binding protein MntB

250 amino acids

Probably part of the ABC transporter complex MntABCD involved in manganese import. Probably responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily.

27.881 kDa

MFPVELDNVTVAYHKKPVLQDISLQVPEGKLIGIIGPNGAGKSTLIKTILGLVPRASGDISIYGKDYKDQRTRIGYVPQRGSVDWDFPTSPLDVVLMGRYGRIGLLKRPKKADVEMAKAALTKVGMHDYAKRQISQLSGGQQQRVFLARALCQNADIYFMDEPFAGVDAATERAIMTLLAELKEKGKTVLVVHHDLQTAEDYFDWILLLHLRKIAFGPTENVFTIENLQKTYGGRLTFLKDKVLAEGHKE

mntB

Manganese transport system ATP-binding protein MntB

240 amino acids

This protein is probably a component of a manganese permease, a binding protein-dependent, ATP-driven transport system. Probably responsible for energy coupling to the transport system (By similarity).

Belongs to the ABC transporter superfamily.

26.47 kDa

MNIQGLTIAYKQKVAIDDVTLQIATGKLTGIVGPNGAGKSTLLKGMMGLVPREKGQVTLDNKPLTYWRKKIAYVPQRSEVDLTFPITVFDMVLLGTYPALGLIKRPGKKEKQLAFDALEQVEMTAFSKRQIGELSGGQLQRVFIARALAQHAEIFFLDEPFAGIDMASEALIMKLLKKLRDNGKTIVVVHHDFHKVAAYFDDIILLNKKLVAHGPVEQTFTEEKIQFAYGDAPVAFAAGV

mntB

Manganese transport system ATP-binding protein MntB

240 amino acids

This protein is probably a component of a manganese permease, a binding protein-dependent, ATP-driven transport system. Probably responsible for energy coupling to the transport system (By similarity).

Belongs to the ABC transporter superfamily.

26.495 kDa

MEIQGLTIAYKQKVAIDNVTLQIASGKLTGIVGPNGAGKSTLLKGMMGLIPREQGQVTLADKPLTYWRKKIAYVPQRSEVDLTFPITVFDMVLLGTYPALGLIKRPGKKEKQLALDALEQVEMTGFMKRQIGELSGGQLQRVFIARALAQHAEIFFLDEPFAGIDMTSEALIMRLLKKLRDNGKTIVVVHHDFHKVAAYFDDIILLNKKLVAHGPVEQTFTEEKIQFAYGDAPVAFAAGV