mltF

Membrane-bound lytic murein transglycosylase F

534 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

60.517 kDa

MQISQFNRLKRSALLFASVLLLSACQIESEPKSEFEQIQERGVLRVGTLNNQLSYYIGPDGPAGLDYELARKFAEQLGVKLEIRPAFRQAELFPALKKGDIDIIATGLNQTSQAVQRFRPGPAYYYVSQQVVYKKGQLRPRDVDQLIKYQESKDEKAGNEDSNAGAETLQIVEQSQFVPTLTALQKEHPELQFEIIGDADTRDLLKHVSTGELRFTVTDSVELSLAQRLYPDLALAFELTEDQPVSWFTRRSEDESLYAMLIEFFGNIKQSGELATLEEKYIGHIEAFDYVDTRAFIRALDNTLPKWSPLFQKYSEEFDWRLIAALAYQESHWKPKAKSPTGVRGMMMLTLPTAKSVGVTDRLDPEQSVRGGVEYLRRIVARVPDSINEHEKIWFALASYNVGYGHMMDARRLTKAQGGDPNAWADVKERLPLLRQKRYYSQTRYGYARGDEARNYVENIRRYYQSIIGHVSQKPAIDEDTEDLQVIPPLDPNLLVSGAVETLAEQVSGAVEVTPPPEENAPQEAEQTPVPKAE

mltF

Membrane-bound lytic murein transglycosylase F

530 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

60.767 kDa

MTPFAYKLPIRALWLGLLSLLLVGCQIDSEPKSELEKIRERGVLRVGTLNNPLSYYIGPDGPTGLDYELAREFAKELGVKLEMKPAYRLSSLFPALKNGEVDIIAAGLSQSEERLKDFRAGPAYYYVSQQVVYKKGDWRPRSFKQLVERQQTLLKDNPELAFFSVVDDSHFEHTLLAKQQKYPDFQFHVDSNSDVNDLLKKVSQGELLFTMADSVEVSLSQRIYPELAAAFELTEDQPISWFIRRSDDESLYALMIEFFGNLKQSGYLASLEEKYIGHIGAFDYVDTRAFIRALDTRLPRWTPLFQKYSAEFDWRLVAALAYQESHWNPYAKSPTGVRGLMMLTLPTARSVGVSDRLDPEQSIRGGVEYLRRMMERVPDSISEHEKIWFALASYNIGYGHMMDARRLTKSQGADPDSWADVKDRLPQLQQKKYFTQTRYGYARGDEARNYVENIRRYYQSIIGHLEQRQLATGDESIEDLTVIALDEEFFNEEANREILDEEAEALESESLENSESSAEPSAKPSTESKN

mltF

Membrane-bound lytic murein transglycosylase F

530 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

60.767 kDa

MTPFAYKLPIRALWLGLLSLLLVGCQIDSEPKSELEKIRERGVLRVGTLNNPLSYYIGPDGPTGLDYELAREFAKELGVKLEMKPAYRLSSLFPALKNGEVDIIAAGLSQSEERLKDFRAGPAYYYVSQQVVYKKGDWRPRSFKQLVERQQTLLKDNPELAFFSVVDDSHFEHTLLAKQQKYPDFQFHVDSNSDVNDLLKKVSQGELLFTMADSVEVSLSQRIYPELAAAFELTEDQPISWFIRRSDDESLYALMIEFFGNLKQSGYLASLEEKYIGHIGAFDYVDTRAFIRALDTRLPRWTPLFQKYSAEFDWRLVAALAYQESHWNPYAKSPTGVRGLMMLTLPTARSVGVSDRLDPEQSIRGGVEYLRRMMERVPDSISEHEKIWFALASYNIGYGHMMDARRLTKSQGADPDSWADVKDRLPQLQQKKYFTQTRYGYARGDEARNYVENIRRYYQSIIGHLEQRQLATGDESIEDLTVIALDEEFFNEEANREILDEEAEALESESLENSESSAEPSAKPSTESKN

mltF

Membrane-bound lytic murein transglycosylase F

529 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

59.732 kDa

MPIFNLHQLRNFLFIIATTLFLSACQIESKPTSELDQIKQRGVLRVGTLNNQLSYYIGPDGQTGLDYELARQFADELGVKLEVKVAFRQAELFPMLKRGDIDLIATGLNQTPRAIKQFRPGPSYYYVSQVVVYKNGALRPRNLKQLVEYQNAKTASEDEAEASNNAAANTLQVVKQSQNVTLLKSLQSDYPELQFTTVSDADNYDLLRRVSTGELRFAISDSIELSLAQRLYPDLATAFEVTEDQPVSWFVRRSPDESLYALMIEFFGNISQSGELARLEEKYIGHIGSFDYVDTRAFIRALDNKLPKWAPLFEQYSAEFDWRLIAALAYQESHWNPLAKSPTGVRGMMMLTLPTAQSVGVKNRLDPEQSIRGGVEYLRRIVARVPESIPQHEKIWFALASYNVGFGHMMDARRLTKRQGGDPDSWGDVKERLPLLRQKKYFSQTRYGYARGDEAKNYVENIRRYYQSIIGHVGQNSLIASDQEGEIQVIPPLENSELVAASDIDAAENEALSPDVGVSQATLTTEVQP

mltF

Membrane-bound lytic murein transglycosylase F

529 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

59.732 kDa

MPIFNLHQLRNFLFIIATTLFLSACQIESKPTSELDQIKQRGVLRVGTLNNQLSYYIGPDGQTGLDYELARQFADELGVKLEVKVAFRQAELFPMLKRGDIDLIATGLNQTPRAIKQFRPGPSYYYVSQVVVYKNGALRPRNLKQLVEYQNAKTASEDEAEASNNAAANTLQVVKQSQNVTLLKSLQSDYPELQFTTVSDADNYDLLRRVSTGELRFAISDSIELSLAQRLYPDLATAFEVTEDQPVSWFVRRSPDESLYALMIEFFGNISQSGELARLEEKYIGHIGSFDYVDTRAFIRALDNKLPKWAPLFEQYSAEFDWRLIAALAYQESHWNPLAKSPTGVRGMMMLTLPTAQSVGVKNRLDPEQSIRGGVEYLRRIVARVPESIPQHEKIWFALASYNVGFGHMMDARRLTKRQGGDPDSWGDVKERLPLLRQKKYFSQTRYGYARGDEAKNYVENIRRYYQSIIGHVGQNSLIASDQEGEIQVIPPLENSELVAASDIDAAENEALSPDVGVSQATLTTEVQP

mltF

Membrane-bound lytic murein transglycosylase F

525 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

59.886 kDa

MQIRHFNRLKRSVLLFASVLLLSACQIESQPKSEFEKIQERGVLRVGTLNNQLSYYIGPDGPAGLDYELARKFAEELGVKLEIKPAFRQADLFPALKKGDIDIIATGLNQTSQAVKRFRPGPAYYYVSQQVVYKKGQLRPRDIEQLIEYQASKDSQSEEDVNAGAQTLKIVEQSQYVPTLTALKKQYPELQFEIVGDADTRDLLKHVSTGELRFTVTDSVELSLAQRLYPDLALAFELTEDQPVSWFTRRSEDESLYAMLIEFFGNIKQSGELASLEEKYIGHIEAFDYVDTRAFIRALDDKLPRWAPLFQKYSEEFDWRLIAALAYQESHWKPKAKSPTGVRGMMMLTLPTAKSVGVTDRLNPEQSVRGGVEYLRRIVARVPDTINEHEKIWFALASYNIGYGHMMDARRLTKAQGGDPNAWADVKDRLPLLRQKRYYSQTRYGYARGDEARNYVENIRRYYQSIIGHVSQKPSIDEDTDDLQVIPPLNPELLISGAVETIAEEVSGASDITNEVDEDLDQEEE

mltF

Membrane-bound lytic murein transglycosylase F

519 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.617 kDa

MKKLKLNYLLIGVVTLLLAVALWPAIPWSGKADNRIAAIQARGVLRVSTIATPLTMYRAGDTMSGLDYELSQAFADYLGVKLKITVRQNISQLFDDLDNNDADLLAAGLVYNEARSQHYQAGPIYYSVSQQMVYRVGSLRPRSLASIKEGQLTIAPGHVAQSELEQLKASKYPDLTWRVDPKLSSNELMLQVAQGTLDYTIADSVAISLFQRVHPQLAVALDLSDEQPVTWFSRRSSDNSLSAALLDFFNQINEDGTLARLEEKYLGHGNDFDYVDTRSFLRAVDSVLPELQPLFEKYATDIDWRLLAAISYQESHWDSQATSPTGVRGLMMLTRNTAQSLGLTDRLDAEQSISGGARYLKDMMSKVPESVPEEERIWFALAAYNMGYAHMLDARALTAKQKGNPDSWSDVKQRLPLLSQRPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLLEKEKQAAAAAQPKLVQSYPTNITPQGLFPSPFSSLPLGPFSQAGAGGKTHSALPNTLSPVSPR

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.288 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.288 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.346 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSVELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTTKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.279 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTINTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.288 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.288 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.317 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMQDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.348 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLCNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.348 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLCNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.5 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFRPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDTVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSIRGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEATMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.331 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNKINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPSPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.302 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

518 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.265 kDa

MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVSQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKDTKFPELSWKVDDKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAEEIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQCLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTELGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN

mltF

Membrane-bound lytic murein transglycosylase F

517 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.076 kDa

MKKFKINYLLIGIVTLLLAAALWPSIPWFGKAENRIAAIQSRGELRVSTLDSPLTYNNVNGKIIGLDYELAQQFADYLGVKLKITVRQNISQLFDDLDNDDADLLAAGLVYNSERSKNYQPGPTYYSVSQQVVYRVGGVRPRTMATLNDQQLTVAPGHVVIDDLRALKEKKYPDLSWKVDEKLGTTALLEQVKDKKLAYTIADSVAISFFQRVHPEIAVALDVTDEQPVTWFSPLDDDQTLSAAILDFFNSMNEEGTLARLEEKYLGHGGDFDYVDTRSFLRAVDSVLPDLQPLFEKYAEEIDWRLLAAISYQESHWDAQATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLQDMMAKVPDTVPEEERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWSDVKQRLPLLSQKPLYNKLTYGYARGHEAYAYVENIRKYQISLVGYLMEKEKEVTKAKQIAQSYPVVSPHELNHPATTSILPFVAFSADGAFERNHLIAPNTLVQAPRR

mltF

Membrane-bound lytic murein transglycosylase F

515 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.911 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKADNRIAAIQSRGELRVSTIESPLTYARINGKKYGLDYELAQQFASYLGVKLKITVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYRVGQYRPRTLATVNESQLSIAPGHVVVNDLQALKETKFPDLSWKVDDKKGTAALLSEVISGNLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSQLDDDNTLSAALLDFFNTINEDGSLARMEEKYLGHGDDFDYVDTRTFLRAVDGVLPDLQPLFEKYAQEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGVRYIQDMMGKVPETVPEEERIWFALAAYNMGYAHMLDARALTVKTRGNPDSWADVKQRLPLLSQKQYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQAAEAIKLAQDYPAVSPAEFDTETFPFSSFLSQPSSNYLSHSPSLPFSLKKKDEN

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.969 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHVAAIQARGVLRVSTIDSPLTYAVVNGKKYGLDYELAQQFANYLGVKLKITVRQNISQLFDDLDNGNADLLAAGLVYDSARVKKYQPGPMYYSVSQQLVYRVGQYRPRSLATVTENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEDVINGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEALFKKYAKEIDWRLLAAISYQESHWDPQATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARALTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAASPEELNKAPFPFISFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.026 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSSTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKTPFPLLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.975 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAIGLFQRVHPELAVALDVTDEQPVTWFSRLDDNNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPLLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.013 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDSGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPFLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.04 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPFLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.969 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHVAAIQARGVLRVSTIDSPLTYAVVNGKKYGLDYELAQQFANYLGVKLKITVRQNISQLFDDLDNGNADLLAAGLVYDSARVKKYQPGPMYYSVSQQLVYRVGQYRPRSLATVTENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEDVINGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEALFKKYAKEIDWRLLAAISYQESHWDPQATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARALTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAASPEELNKAPFPFISFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.026 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSSTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKTPFPLLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.975 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAIGLFQRVHPELAVALDVTDEQPVTWFSRLDDNNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPLLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.013 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDSGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPFLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.04 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAVSPEELNKAPFPFLSFLSQSSGYLTHSPSLLFTPQKKEEK

mltF

Membrane-bound lytic murein transglycosylase F

514 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.181 kDa

MLSNNPLITKFRELFTVALVLALLSGCQWQDDNLTDLEKIRESGVIRVGTLNNQLSYYIGNDGPTGLDYELAQRFAQKLGVKLEMQPMFTLSGLFPTLERGGIDVVAAGLTISKDRIENYHAAPAYYYASQIVVYKNGQWRPRKPADLALNKGTLSVVKGSSHEKHLIKLKEIHPDLTWESIEETDSDELLRLVAKGELDFTIADSVDVALSQRIHPDVAIAMELTEDEPIAWFVNKSTDDSLYALLIEFFGEIKQSGELAQLEEKYFGHVGSFDYVDTRAFLRAIESKLPRWESLFKKYSNEFDWRLIAALSYQESHWNPQAVSPTGVRGMMMLTLPTAKSVGVKNRLDPEQSIRGGAEYLRKMISRVPDSIESHEKVWFALASYNVGFGHMMDARRLTHKQGGNQDTWTDVKQRLPLLRQRKYYQQSRYGYARGDEALNYVENIRRYYQSIIGYEQAHSHDYDSDDVQVVDGLQTITLPPVPPRQANVDGSLNNEAAISSAEKTIEDPGPSQ

mltF

Membrane-bound lytic murein transglycosylase F

511 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.908 kDa

MKKLKINYLLIGIVTLLLAAALWPSIPWSGKPENRVAGIIARGELRISTINSPMTFATMNNKAFGLDYELAKQFADYLGVTLKITVRQNISQLFDDLDDGQADMLAAGLVYNQERVKNYQAGPTYYSVSQQLVYRVGNTRPRTLAALTAEQLTIAPGHVAINDLQTLKAEKYPDLAWRVDEKRGTTALMQAVIDGKLDYTIADSVAVSLFQRVHPELAVALDITDEQPVTWFSARDDDNSLSAAMLDFFNNINEDGTLARLEEKYLGHGNDFDYVDTRTFLRAVENILPEVQPLFEKYAREIDWRLLAAIAWQESHWDPQATSPTGVRGMMMLTRNTAQSLGLTDRTDAAQSIDGGMRYLQDMMDKVPDSIPKDERIWFALAAYNMGYAHMLDAMALTRKQKGNPNSWADVKLRLPLLSQKPYYSKLKYGYARGHEAYAYVENIRKYQISLVGYLSEKERQQQQTLALAEDYPAVLPNELEQPQETTLPFFKFRADKQMDNARMKLPGHLY

mltF

Membrane-bound lytic murein transglycosylase F

509 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.886 kDa

MLASACTHSWRTGRFLNRIIKSSVQTLTAAALIANLSACSRPTTLEKIEQEGALHVITRNAPTTYYEDRDGPAGFEYELAKKFSEYLGVELRLRVANDLDEAYTVLEQNYTNLAAVGLSRLAASAQSPSLRFSSEYLEIQPLVLYRNGSAKPKQLDDLIGGKLIIPAQTAQAEFLRQVKDSRLPDMDWLEAADMETSEIMRLIEEGEYEYAIVNSREYEIHKAMFPRAREAFSLMEPLQISWIFPPGEDMSLIQKADEFIKQIKDDGTLIYLQERYFGHVNQLNYVGARTYISHIKDRLPKFEPTFKQAAEKFEVDWRLLASIGYQESHWRPYATSPTGVRGLMMLTLPTAKEMNVKNRLNPEQSIFGGAGYFSRIKQRISERITEPDRTWMALAAYNVGLGHLEDARALAKAQGLDQDKWIDVKQALPLLQQKKWYVKTRYGYARGWEPVHYVQNIRRYYDVLVWMTQPSAEDGSVAQNEDAPTTGADGTTEETPAIPAPFRVTPPML

mltF

Membrane-bound lytic murein transglycosylase F

507 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

58.263 kDa

MRRYPTLVVLLLLVLLPVLGCDLSMKRPIMDEIRKTGVLVVVTRNAPTTYYQGRDRVEGFEHDLATLFAAHLGVKVAFIKKQSRGEVLQTLHEGKAHLAAAGLVRQEEDGDRYLYGPDYQSVFQQVVCRRGGVRPTNLLKLTQAKLTVVKESAYEDRLRELQQLVPQLTWHSDDNLSVEQVLEQVWLGKVDCTLADSNVVALNRRYYPELTVKFPINAEQRLAWTLPKRAVFLHKEVVTWFNEIRSNGQLDELFEKYYGFVEGQSFDFVDNRQFIKRMSERLPSYKHLFMEAARKYHIPWQLLAAQAYQESHWDPKARSSTGVRGIMMLTQVTAKALGIDDRLDPKSSIHGGAWYLSNMRRRLPSTITEPDRTWIALAAYNVGLGHISDARRLAKKQNLNPNRWSDLRQVLPLLSQSKYFKDTKFGYARGDEPVRYVAKVRHYNDILTRMERKNYTGETTPFVEPNTALPMVPLKEQAVIGEINPMDGRMVETSGKEAAVPSPKRRY

mltF

Membrane-bound lytic murein transglycosylase F

502 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.385 kDa

MSRFISTFRSSSAQLSIVLAVILATGCSQPTTLQEIREEGVLHVITRVAPSIYYQDREQDTGYDYELARLFANELGVELRVRVADDNSEILSVLSRNYAHVGLAGLTQRPDFDNQYRSVPIGVSAQSVIVYHKEVPAPESLEDLASETIHMLADSNHEHLIADPANEAGPIIQKHPGLDAAGLLARVESGEFGYAAVASNELDLNHVFFPKVYEAFALNEPSDLVWLFPAAQDDTLVNAAEAFMERVNNNGTMAQLAERFYGHLDRLNYVGARTFMHHVENRLPRYQSLFKDYAQESGMDWRLLAAIGYQESHWRPNAVSPTGVRGLMMLTRTTANYIGINNRLDAEESIEGGARYFRMVHGRIPDRIPEPDRTWFALASYNVGFGHLEDARRLAESAGKDPDRWMDVKEFLPLLAQKEWYTKTRFGYARGHEPVVYVQNIRRYYDVLVRITEPDAPSASGLEDQLAWLGDNEAGPEAPAKESQPDLRADLPPELRLIPPTL

mltF

Membrane-bound lytic murein transglycosylase F

501 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.694 kDa

MTKILLNTASTVLTRLWKLSLLGLVFAVAAATLVSSRIPTTLEEVKSSGKLIVISRNGPTTYYEGPAGHTGFEYVMAKAFAKHLGVDLEVREIEDLGEMLDKVGTKAGHLAASGLTVTEKRARKVLFAEPYLQVTQQLIYRSGESKPETIEDLYGKRVMVISNSSHSERLKELQREYRDLAWEEQHDVDMLDLLEMVHNGKIDYTIVDSNAYQINRPVYPKATVAFDISEPQDLAWAFPQQKDASLYNEAQKFFKDIKQTGAIDDAMETFYGHLGEIDYSGAILFAHRLQSRLPKWETHLKAAAEKNDLDWQLLAALSYQESHWNPKAKSPTGVRGFMMLTLNTAKEVGVKNRLNAEQSIYGGARYFKSLHGRLPERIKEPDRTWLALAAYNIGLGHLEDARILTEHFGGNPDKWADVKQQLPLLAKRKYYKFTKHGYARGWEAVDYVQNIRNFHTIIAWNEIENQRLQQLAQNENHVSDYAQFSPTVTEAVKSISGTSSL

mltF

Membrane-bound lytic murein transglycosylase F

501 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.694 kDa

MTKILLNTASTVLTRLWKLSLLGLVFAVAAATLVSSRIPTTLEEVKSSGKLIVISRNGPTTYYEGPAGHTGFEYVMAKAFAKHLGVDLEVREIEDLGEMLDKVGTKAGHLAASGLTVTEKRARKVLFAEPYLQVTQQLIYRSGESKPETIEDLYGKRVMVISNSSHSERLKELQREYRDLAWEEQHDVDMLDLLEMVHNGKIDYTIVDSNAYQINRPVYPKATVAFDISEPQDLAWAFPQQKDASLYNEAQKFFKDIKQTGAIDDAMETFYGHLGEIDYSGAILFAHRLQSRLPKWETHLKAAAEKNDLDWQLLAALSYQESHWNPKAKSPTGVRGFMMLTLNTAKEVGVKNRLNAEQSIYGGARYFKSLHGRLPERIKEPDRTWLALAAYNIGLGHLEDARILTEHFGGNPDKWADVKQQLPLLAKRKYYKFTKHGYARGWEAVDYVQNIRNFHTIIAWNEIENQRLQQLAQNENHVSDYAQFSPTVTEAVKSISGTSSL

mltF

Membrane-bound lytic murein transglycosylase F

501 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

57.042 kDa

MTKFTSLLLVIFTTVLLSACDKENDSSSLSRILARGYINVGTIFGPTNYYTTANGFAGFEYELAKQYADSLNVELRIVPTYSLDELFIKLNTGEVDLLASGLSITDKRLQRFRFAPSYETISQKLVFKQGNVRPRKVADLTGTLMVTSGSSYVENLEKLKQTNSELAWQESTEFDSEELLRKVLSGEIDYTIIDSNNLAINRRYYPEISIGFSINEPEPLAWMVSENSHDDILASLVEFFGTVHHDGTLLALDDKYYGHIEQFNYVETRTFIKAVAGTLPEYQPLFEKYAQELDWRLLAAISYQESHWNPTARSYTGVRGMMMLTLATAKQMGIKSRLDTEQSIQGGAKYFKRMIAMMPDRIPTPDRIWFALASYNIGFGHLNDARIITQRQGGDPDRWVEVKSRLPLLQQKKYYKNTKHGYARGEEPVQYVDNIRRYYDTLSWLDEKAKEQAIALQLAQEKSQALLLNDIVNDSVNESTSEENATESILKEEEVTAETAQ

mltF

Membrane-bound lytic murein transglycosylase F

498 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.897 kDa

MFFKPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETPLRKQQARFSHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQNPGIQYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEARAQRWAVAPGEDNSLLNEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKEQVDWRLLAAIGYQESMWQPTVTSKTGVRGLMMLTQNTAQAMGVSNRLDARQSIQGGAKYFAYIKDQLDDSIKEPDRTWLALASYNIGSGHLEDARKLAQNEGLNPDKWLDVKKMLPRLAQKKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPPVPPASPVPSSSSTDESPL

mltF

Membrane-bound lytic murein transglycosylase F

498 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.897 kDa

MFFKPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETPLRKQQARFSHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQNPGIQYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEARAQRWAVAPGEDNSLLNEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKEQVDWRLLAAIGYQESMWQPTVTSKTGVRGLMMLTQNTAQAMGVSNRLDARQSIQGGAKYFAYIKDQLDDSIKEPDRTWLALASYNIGSGHLEDARKLAQNEGLNPDKWLDVKKMLPRLAQKKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPPVPPASPVPSSSSTDESPL

mltF

Membrane-bound lytic murein transglycosylase F

497 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.849 kDa

MFFRPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETSKRKQQARFSHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQTPAIEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEAREQRWAVAPGEDNSLLNEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKEQVDWRLLAAIGYQESMWQPAVTSKTGVRGLMMLTQNTAQAMGVTNRLDARQSIQGGAKYFAYVKDQLDDKIQEPDRTWLALASYNIGGGHLEDARKLAENEGLNPNKWLDVKKMLPRLAQKKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPPAPTAPVVPASSPEKPAL

mltF

Membrane-bound lytic murein transglycosylase F

497 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.849 kDa

MFFRPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETSKRKQQARFSHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQTPAIEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEAREQRWAVAPGEDNSLLNEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKEQVDWRLLAAIGYQESMWQPAVTSKTGVRGLMMLTQNTAQAMGVTNRLDARQSIQGGAKYFAYVKDQLDDKIQEPDRTWLALASYNIGGGHLEDARKLAENEGLNPNKWLDVKKMLPRLAQKKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPPAPTAPVVPASSPEKPAL

mltF

Membrane-bound lytic murein transglycosylase F

496 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.738 kDa

MFFRPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRMITRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETPKRKQQARFSHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQNPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEAREQRWVVAPGEDNSLLNEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKEQVDWRLLAAIGYQESMWQPAVTSKTGVRGLMMLTQNTAQAMGVTNRLDARQSIQGGAKYFAYVKDQLDDSIKEPDRTWLALASYNIGSGHLEDARKLAQNEGLNPDKWLDVKKMLPRLAQKKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPPAPPAPASGSSPDKPAL

mltF

Membrane-bound lytic murein transglycosylase F

496 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.811 kDa

MPIFSTRVLTYLRCIFRLFIGLTLLLTLVGCDFYTPSSQLEQIRQRGEIRVGTIYGPTSYYQRDDTAQGFDYELAQSYADWLGVKLTIVPVYSTAELVELLRKGKLDLAAAAIVVTPERRQLFRFGPGFYQVSPKLVYRNGSPKPKDIGDLKGNIVVPAGSTGEDLLKELAKQYPNLKWSTNRDADVEELLKQVADGKIDYTVVQDTVLARTQRYYPELTEGMTLAKNQTVAWAMTKLPDDSLYASIIDFFGQRFMDGAIAKLDEKYFGHVQNFDFVDTRTFLQRAKSLLPKYQDLFKTHANVVDWRLLAAISYQESHWDPEARSYTGVRGMMMLTEPTAKAMGVNNRLHPEESIKGGARYLEQMMEKVPASVPDDEKVWFALTAYNIGYGHMMDARRLTKELGKNPDAWSDVKEVLPLLQQSRWHRKVRYGYARGGEARNYVNNVRQYYQSLLWLDNEQQKAHRREELDDDDSSEPPSAERPTVIAEVVKQITLR

mltF

Membrane-bound lytic murein transglycosylase F

496 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.835 kDa

MPIFSTRVLTYLRCIFRLFIGLMLLLTLVGCDFYTPSSQLEQIRQRGEIRVGTIYGSTSYYQRDDLAQGFDYELAKSYADWLGVKLTIVPVYSIAELVELLEKGKLDLAAAAIVVTPERRALFRFGPGFYQVSPKLVYRYGSPKPKDIGDLKGSIVVPAGSTGEDLLRELAKEYPGLKWSTNRDADVEELLKQVADGKIDYTVVQDTVLARTQRYYPELTEGLTLSKNQTVAWAMTKLPDDSLYASIIDFFGQRFMDGAIAKLDEKYFGHVQNFDFVDTRTFLQRAKSLLPKYQDLFKTHARMVDWRLLAAISYQESHWDPQARSYTGVRGMMMLTEPTAKAMGVKDRTHPAESIEGGARYLQHMMEKVPASVPTDEKVWFALTAYNIGYGHMMDARRLTKELGKNPDAWSDVKEVLPLLQQARWHRKVRYGYARGGEARNYVNNVRQYYQSLLWLDNEQQKAHRREELDEDDSSEPQSTERPTVIAEVVKQITLR

mltF

Membrane-bound lytic murein transglycosylase F

495 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.912 kDa

MSRIRHHRFIQSCLVISTLLITLTGCQVESEPKTKLEQIRERGILRVSTLNNQLSYYIGSNGPTGLDYDLAKAFAEKLEVKLEITPAYTYSGLFPALERNEVDIIAANMTITPERLQKFRPGPVYYYVSQQVVYKKGSWRPRNIKNLTQLDENLTIVKDSSFEGTLIKLKEKYPNLDWNTAADTDVSELLKKVATGEIHYTLADSVELSLTQRIHPDLAVAFEVTEDQPVAWFLQQTEDDSLQALLIEFFGELKESGKLALLEEKYFGHVESFDYVDTRAFIRALESKLPKWEPLFKKYAGDFDWRFLAALSYQESHWNPLAKSPTGVRGMMMLTLPTAQSVGVKNRLNPEQSIRGGAEYLRRIVKRVPDSITEHEKIWFALASYNIGFGHMMDARRLTQRLGGDPDSWTDVKDNLPLLRQQRYYRYLRYGFARGDEAQNYVENIRRYYQSIIGYEQEQANKLKQEELTVEDLQVIDVPLSSAEASVSQAIETKK

mltF

Membrane-bound lytic murein transglycosylase F

495 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.967 kDa

MEIRKLSLSTIRSIITSLSVLVLVISASATLVRSTPPNVLEQVLASGELRVISTNGATTFYEGSDGLTGFEYSLLKGFADSLGVNLAIENQADTRELLHAVEQRQYHMGSAELTALESQDYHLSFAKPYMQITQQLVYNHRLGTPTSIKDLKGKEVLILADSAHSKRVARLQKKFPNLTWRPIENGQMIDLLEMVHKGEADYAVIDSNAYELHRYSYPRAKLAFDISNPQPLAWAFPHSKDTSLFDAAQRYMAQIKRDGSLAQVTKHFFERHIDEVTTGEAMVFAYRLQNRFPQWSDAMKSAATEFDLDWQMLAAIGYQESHWLADAESHTGVRGLMMLTKRTARAMGVNNREDPLQSIYGGAKYFRMMLDRLPERIQGDDRLNLALAAYNQGAGHLEDARVLTQRMGGNPDKWEDVRKYMPLLSKSQYYSRAKHGYMRGWEPVQFVDNVRNYHKIIAWHEQQNELRLASYSGGALSSLHKAPTETAAQGENLSL

mltF

Membrane-bound lytic murein transglycosylase F

494 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.073 kDa

MIKYLYVILLGLLLSGCQPAEVVEIEASPKAQKRTVLKVGTLYGPQIYVNNSQGETGFDYEMANRFADYLGVSLEMIPFTDRKQLFKALKDNDIDIIAAGIAKTPGRGEQFKMGPTLYKVNQVLVYREGTPEPKDIGTLSGEITVMSNSSSVNTLTQLQKDYPELLWNQVNDKDNEELFALIAKGELNYTISDSNSLLINQRFLPELRAGMILEEKIEVVWLLPPKNSDKLMSQLLAFWHNEQRAGTLEHLNEKYFGHVKRFDYVDTRAFIRAIDNVLPAYRSLFETYSGELDWRKLAAASYQESHWNPNARSKTGVRGMMMLTQPTASYVGVSDRTDAEQSIRGGAIYLKDMIERLPESISDSQRIWFALAAYNIGMGHVEDARRLAVSMDMDPDAWRDVKKVLPLLQQRKYYKQTRYGYARGSQAVHYVDSIRRYYDTLVWVDNQTKKMEVIEAPVEILADKVDANDNIKQSLASDSKTNNTLKPKLGAGQP

mltF

Membrane-bound lytic murein transglycosylase F

494 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.073 kDa

MIKYLYVILLGLLLSGCQPAEVVEIEASPKAQKRTVLKVGTLYGPQIYVNNSQGETGFDYEMANRFADYLGVSLEMIPFTDRKQLFKALKDNDIDIIAAGIAKTPGRGEQFKMGPTLYKVNQVLVYREGTPEPKDIGTLSGEITVMSNSSSVNTLTQLQKDYPELLWNQVNDKDNEELFALIAKGELNYTISDSNSLLINQRFLPELRAGMILEEKIEVVWLLPPKNSDKLMSQLLAFWHNEQRAGTLEHLNEKYFGHVKRFDYVDTRAFIRAIDNVLPAYRSLFETYSGELDWRKLAAASYQESHWNPNARSKTGVRGMMMLTQPTASYVGVSDRTDAEQSIRGGAIYLKDMIERLPESISDSQRIWFALAAYNIGMGHVEDARRLAVSMDMDPDAWRDVKKVLPLLQQRKYYKQTRYGYARGSQAVHYVDSIRRYYDTLVWVDNQTKKMEVIEAPVEILADKVDANDNIKQSLASDSKTNNTLKPKLGAGQP

mltF

Membrane-bound lytic murein transglycosylase F

493 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.87 kDa

MKRLRFNYLLIGLITVLLALALWPSIPWYGGSTDRIAQIKSRGELRISTINSPLTYYTVNQSPAGMDYELAKRFADYLGVRLVVTVRPNLADLFDDLADDKADILAAGLIYNRERLKRFRAGPSYYSVSQQLVYRIGTSRPKNLGDLKGRLTVASGSAYLSSLREIKDRQYPDLDWAVSTDRTPDGLLQAVADGKIDYTIADSVSIGLMQRIHPQLTVAFDITEEEAVTWYTQQEANDSLNAAMLDFFSKMSEEGVIARLDEKYLGHVGTFDYVDTRTFLRSIDETLPDIRRLFEKYAKKIDWRLLAAISYQESHWDPLATSPTGVRGMMMLTRSTADSLNVSDRTDAEQSIRGGSEYMTHMMEKVPSGVPEDERIWFALAAYNMGYAHMLDARKLTEKQKGDPNSWADVKVRLPMLSQKRYYSQTTYGYARGHEAYAYVENIRKYQLSLVGYLQDRERKLAQKMAAEAELRQAYPAVEPDAALNPVSALPLP

mltF

Membrane-bound lytic murein transglycosylase F

492 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.176 kDa

MKGLFLRIIAIVALLLWAIDMVFPWQQIMRSEENRYTAIQSRGKLVVGTINNPISYFIDHAGQAAGLEYELSKAFADYLNVDLEILAMSNGDELFSALKNNKIDIAAANLLYQPNKLDMFQVGPTYNSASWQLVYRKGTERPRSLGELKGSLSIASGSELTELLKVEKEKYPDLIWRVNEKLTPEELLIQMADGKIDYVIANSIDVSAVQQIKPNVAVAFDVTDESTVHWYLPSNSYSELQASLLDFMNSAIETGLIARIEEKYFNHLAQFDYVDTRSYLRAIETVLPKFAPLFEKYKGDLDWCLLAAIAYQESHWNPDATSPTGVRGMMMLTKATAERMRIQDRTDPEQSIKAGSEYLHWLITQMPDTIKEDERIWFALAAYNMGLGHLLDARRLTKSLGGDPDNWLDVKKNLPLLAEKRYYTGLKYGYARGYEAYHYVENIRRYMNSIVHYYRVQQAQIEETLDTQAAEIENINEIKKETDTLATTVTTQ

mltF

Membrane-bound lytic murein transglycosylase F

490 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.095 kDa

MFALTAYRLRCAAWLLATGIFLLLAGCSEAKAPTALERVQKEGVLRVVTRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSRAGGPALAAAGLTPGRQDDASVRYSHTYLDVTPQVIYRNGQQRPTRPEDLVGKRIMVLKGSSHAAQLAELKKQYPELKYDESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPSATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIREPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKRWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQMEGSQIAESGLHLPGVNKTRPDDDEGDGKL

mltF

Membrane-bound lytic murein transglycosylase F

490 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.227 kDa

MFALTAYRLRCAAWLLATGIFLLLAGCSEAKAPTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQMEGSQIAESGLHLPGVNKTRPEEDSGDEKL

mltF

Membrane-bound lytic murein transglycosylase F

489 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.111 kDa

MFALTAYRLRCAAWLLATGIFLLLAGCSEAKAPTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQMEGSQIAESGLHLPGVNKTRPEEDSGDEKL

mltF

Membrane-bound lytic murein transglycosylase F

488 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.83 kDa

MFARPAIRMRCATGLLAIGTLLMLAGCGEEPKPSVLEQVKAEGELRVVTRNSPATYFQDRNGATGFEYELAKRFATDLGLELKIETADNLDSLFASLGHVDGPVLAAAGLVETPQRQRQARFSVPYLEVTPQIIYRQGETRPTKAEDLLGKRILVLAGSSHAEQLEALKLELPELTFEVSDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGDTNTMRWAVAPGEDDSLLLEIDAFLERSQANGTLQRLKERYYGHVDVLGYVGAYTFAQHLQQRLPRYEKMFRQAGHANQIDWRLLAAMGYQESLWQPNATSKTGVRGLMMLTQRTAQSVGVSNRLDPKQSIDGGARYFVQIHQQLPESIQEPDRTWFALAAYNVGGGHLEDARKLTEAEGLDPNKWMDVQKILPRLAQKQWYSKTRYGYARGGEPVHFVRNVRRYYDILTWVTQPQLEGTQVAENGIHLPGIDKRTLDEQTPPL

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.775 kDa

MFAHTLFRKRCAIWLLAIGIFLMLGSCAEKPSELERIKEEGVLRVITRNSPSTYFQDRNGEAGFEYELVKRFASTLGVELQIETADNIDDIFSRLNRPGGPALAAAGLVASEGRQELARFTRSYLDVTTQVVYHSGQRRPTSPKDLIGKRILVLKGSSQAEKLASLQVEYPELRYDESDAVEVVDLLRMVDEGQIDLTLVESNEMSMNQVYFSNIRAGFDVGEQNSLAWVVAKGEDDSLLKAADAFLEQAQQNGTLQRLRERYYGHVDVLGYVGAYAFAKHLQQRLPRYEKAFRETAKEHGIDWRLLAAIGYQESHWQPEATSKTGVRGLMMLTLRTANAMGVTNRLDPVQSIQGGGKYLVQVHASLPESIEEPDRTWFALAAYNVGGGHLEDARKLAEAEGLDPNKWLDVKQMLPRLSQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQMEGQQLAKSELHIPGINSTDLMEELPPL

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.634 kDa

MKRLKINYILIGVVTLLLALALWPNITWRGGQGGQLEEIKSRGELRISTLNSPLTYFTTKQGPSGLDYELAKRFANYLGVKLVVIPHKNINDLFDDLDDDDADLLAAGLIYNQDRLSRARTGPAYYSVSQQLVYRLGTARPKTFADIKGKLAVASGSAHVSTLKQLKQSKFPDLSWEASSDLTSKELLEQVADGKLDYTLGDSVTIALLQRIHPQLAVAFDVTDEEPVTWYLKRGTDDSLYAAMLDFYSQMVDDGTLARLEEKYLGHVGSFDYVDTKTFLSAIDSVLPTFRSLFEKYASEIDWKLLAAIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVNDRLDPEESIQGGALYLQRLMAKVPDSVPEDERIWFSLAAYNMGWGHMLDARKLTKMQKGNPDSWVDVKQRLPMLSQKRYYPQLTYGYARGREAYNYVENIRRYQVSLVGYLQEKERKAAQEAAEQADQGKGYPAVTPELALNF

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.775 kDa

MFAHTLFRKRCAIWLLAIGIFLMLGSCAEKPSELERIKEEGVLRVITRNSPSTYFQDRNGEAGFEYELVKRFASTLGVELQIETADNIDDIFSRLNRPGGPALAAAGLVASEGRQELARFTRSYLDVTTQVVYHSGQRRPTSPKDLIGKRILVLKGSSQAEKLASLQVEYPELRYDESDAVEVVDLLRMVDEGQIDLTLVESNEMSMNQVYFSNIRAGFDVGEQNSLAWVVAKGEDDSLLKAADAFLEQAQQNGTLQRLRERYYGHVDVLGYVGAYAFAKHLQQRLPRYEKAFRETAKEHGIDWRLLAAIGYQESHWQPEATSKTGVRGLMMLTLRTANAMGVTNRLDPVQSIQGGGKYLVQVHASLPESIEEPDRTWFALAAYNVGGGHLEDARKLAEAEGLDPNKWLDVKQMLPRLSQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQMEGQQLAKSELHIPGINSTDLMEELPPL

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.634 kDa

MKRLKINYILIGVVTLLLALALWPNITWRGGQGGQLEEIKSRGELRISTLNSPLTYFTTKQGPSGLDYELAKRFANYLGVKLVVIPHKNINDLFDDLDDDDADLLAAGLIYNQDRLSRARTGPAYYSVSQQLVYRLGTARPKTFADIKGKLAVASGSAHVSTLKQLKQSKFPDLSWEASSDLTSKELLEQVADGKLDYTLGDSVTIALLQRIHPQLAVAFDVTDEEPVTWYLKRGTDDSLYAAMLDFYSQMVDDGTLARLEEKYLGHVGSFDYVDTKTFLSAIDSVLPTFRSLFEKYASEIDWKLLAAIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVNDRLDPEESIQGGALYLQRLMAKVPDSVPEDERIWFSLAAYNMGWGHMLDARKLTKMQKGNPDSWVDVKQRLPMLSQKRYYPQLTYGYARGREAYNYVENIRRYQVSLVGYLQEKERKAAQEAAEQADQGKGYPAVTPELALNF

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.915 kDa

MFSPMALRPRCAKWLIVTGLFLMLGACVEKPSTLERVKEDGVLRVVTRNSPATYFQDRNGETGFEYELVKRFADDLGVELKIETADNLDDLFDQLGQPKGPVLAAAGLVSSEQRKQQVRFSHPYLEVTPQVIYRNGRSRPTTAQDLVGKHIMVLKGSTHAEQLAELKLKYPGIEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGDARSQSWAVAAGDDNSLLNEINSFLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKASAKQEKLDWRLLAAVGYQESMWQAEVTSKTGVRGLMMLTQNTAQAMGVSNRLDPKQSISGGAKYLAYIKEQLDDKIEEPDRTWFALAAYNVGTGHLDDARKLAEKEGLNPNKWLDVKKMLPRLSQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGDQVAEGNLHVPGVNKTKPPEENPPL

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.724 kDa

MFSPTALRPRYAKWLIATGLFLMLSGCVDKPNTLERVKEDGVLRVVTRNSPATYFQDRSGETGFEYELVKRFADDLGVELKIETADNLDDLFNQVGKPNGPVLAAAGLVSSEQRKKQVRFSRSYLEVTPQIIYRNGQSRPTDAGDLVGKKIMVLKGSTHAEQLAELKQKYPGIQYEESDAVEVVDLLRMVDEGQIDLTLVDSNEVAMNQVYFTNIRVAFDLGDARSQSWAVAAGEDNSLLNEINSYLDKVQKNGTLQRLKDRYYGHVDVLGYMGATTFAQHLQQRLPKYEQHFKAYAKKEKVDWRLLAAIGYQESLWQPAVTSKTGVRGLMMLTQNTAQAMGVSNRLDPKQSIMGGAKYLAYMKDQLDESIQEPDRTWFALAAYNVGSGHLDDARKLAAKEGLNPDKWLDVKKILPRLSQKQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGDQVAEGNLHVPGIDKSKPAQEPAPL

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.685 kDa

MTRIKLNYFVIGVVALLLALALWPNIPWRNGQEGQLDRIKARGELRVSTISSPLIYSTGKDGPSGFDYELAKRFADYLGVKLVMTPHHNINDLFDTLDSDDADMIAAGLIYNSERLKRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQLIVASGSAHMTTLKQLKQTKYPDLNWGSSVDRSGKELLEQVADGKLDYTLGDSVTIALLQRIHPQLAVAFDVTDEEPVTWYFQQSHDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSFRPLFEKHAGEIDWRLLAAIAYQESHWNPQATSPTGVRGLMMLTRATASGLGVKDRVDPEESIRGGSVYLQRLMQKVPDTIPEDERIWFALAAYNLGYGHMLDARKLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKAYPVVGPGWSINN

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.836 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRVTADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.836 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRVTADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

486 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MTRIKLSYFTIGLVALLLALALWPNIPWRNGQEGQLDQIKARGELRVSTISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRLKQTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQLAVAFDVTDEEPVTWYFKQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLGHVGSFDYVDTKTFLSAIDNVLPSYQHLFEKHAGDIDWKLLAVIAYQESHWNPQATSPTGVRGLMMLTRATADGLGVKDRVDPEESIRGGAIYLQRLMKKLPETIPEDERIWFALAAYNLGYGHMLDARRLTKNQNGNPDSWVDVKMRLPMLSQKRYYPSTTYGYARGHEAYNYVENIRRYQVSLVGYLQEKEKKAAQHAAIEAELGKSNPVVGPGWSIGD

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.012 kDa

MFAHTALRQRCAKWLFATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVQHFAEDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKAQVKYSHPYLEVTPQVIYRNGRPRPTNAKGLVGKKIMVLKGSSHADLLAELKKQNPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDVGDTRDQRWAVAAGEDNSLLNEINEFLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPKQSIQGGAKYFMKIKEELDDSIQEPDRTWFALAAYNVGTGHLEDARTLAKREKLNPNKWLDVKKMLPRLSQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPADQSPPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.044 kDa

MFAHTALRQRCAKWLLATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVQHFADDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKTQVRYSHPYLEVTPQVIYRNGRPRPTGAKGLVGKKIMVLKGSSHADQLAELKKQYPALQYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGETRDQRWAVAAGEDNSLLNEINEYLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIQGGAKYFMKIKEELDDSIKEPDRTWFALAAYNVGGGHLEDARTLAKREKLNPNKWLDVKKMLPRLAQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPADKSSPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.284 kDa

MFAHTALRQRCAKWLFATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVKLEIETADNLDELFDDLGKPSGPVLAAAGLVNSERRKTQARFSHPYLEVTPQVIYRNGRSRPTDPKGLVGKKIMVLKGSSHADQLAELKRRYPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGETRNQRWAVAPGEDNSLLNEVNEFLDKSQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKYFKSYAKVEQVDWRLLAAIGYQESLWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIKGGAKYFMLVKQQLDDSIKEPDRTWFALAAYNVGSGHLEDARTLAKREKLNPNKWLDVKKMLPRLSQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPAEQSPPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.012 kDa

MFAHTALRQRCAKWLFATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVQHFAEDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKAQVKYSHPYLEVTPQVIYRNGRPRPTNAKGLVGKKIMVLKGSSHADLLAELKKQNPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDVGDTRDQRWAVAAGEDNSLLNEINEFLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPKQSIQGGAKYFMKIKEELDDSIQEPDRTWFALAAYNVGTGHLEDARTLAKREKLNPNKWLDVKKMLPRLSQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPADQSPPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.044 kDa

MFAHTALRQRCAKWLLATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVQHFADDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKTQVRYSHPYLEVTPQVIYRNGRPRPTGAKGLVGKKIMVLKGSSHADQLAELKKQYPALQYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGETRDQRWAVAAGEDNSLLNEINEYLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIQGGAKYFMKIKEELDDSIKEPDRTWFALAAYNVGGGHLEDARTLAKREKLNPNKWLDVKKMLPRLAQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPADKSSPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.284 kDa

MFAHTALRQRCAKWLFATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVKLEIETADNLDELFDDLGKPSGPVLAAAGLVNSERRKTQARFSHPYLEVTPQVIYRNGRSRPTDPKGLVGKKIMVLKGSSHADQLAELKRRYPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGETRNQRWAVAPGEDNSLLNEVNEFLDKSQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKYFKSYAKVEQVDWRLLAAIGYQESLWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIKGGAKYFMLVKQQLDDSIKEPDRTWFALAAYNVGSGHLEDARTLAKREKLNPNKWLDVKKMLPRLSQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPAEQSPPM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.842 kDa

MFAHTAFRQRCARWLFATGLFLMLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVKRFADDLGVKLQIETADNLDELFDQLGKPSGPVLAAAGLVSSERRGAQARFSHPYLEVTPQVIYRNGRSRPTNAKGLVGKKIMVLKGSSHADQLAELKKQNPGLEYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGDTRDQRWAVAAGDDNSLLNEINEFLDKSQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKATSKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPKQSIQGGAKYFMVVKDQLDDSIKEPDRTWFALAAYNVGSGHLEDARTLAKREGLNPNKWLDVKKMLPRLSQKQWYSKTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPAEQSPQM

mltF

Membrane-bound lytic murein transglycosylase F

485 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.99 kDa

MFAHTALRQRCAKWLLATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNGETGFEYELVQHFADDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKTQVKYSHPYLEVTPQVIYRNGRARPTGAKGLVGKKIMVLKGSSHADQLAELKKQYPALQYEESDAVEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGDTRDQRWAVAAGEDNSLLNEINEFLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVEQVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIQGGAKYFMKIKEELDDSIQEPDRTWFALAAYNVGSGHLEDARTLAKREKLNPNKWLDVKKMLPRLAQKQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPADKSSPM

mltF

Membrane-bound lytic murein transglycosylase F

484 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.745 kDa

MKGLLLRIIAAFALVLWAIDMVFPWQQMMRSEENRYNAIQQRGKLVVGTVNNPVSYFIGNEGQAGLEYELSRAFADYLGVELEMKAMDNGEQLFDALEDNEIDIAAANLLYQAKKAETFQLGPAYYSASWQLVYRKGESRPQSLSQIKDKLIIARGSELPLILQGYQTKYPNLKWQLENNQTQEELLLQVAQGKIKYTVANSIDVSAVQQVRPEIAVAFDVTDEASVHWYLPNNSYNELQAALLDFMNTALEGGLIARIEEKYFNHFSQFDYVDMRQYVQAINDILPKYAPLFDRYKGDLDWRLLAAIAYQESHWNENATSPTGVRGMMMLTKDTAERMKIADRTDAEQSIKAGSEYLHWLISQVPDSIPKEDRIWFALTGYNMGLGHMLDARRLTKNLGGDPDNWLDVKKNLPLLAEKRYYPNLKYGYARGYEAFQYVENIRRYMNSIINYYRVQENADNKDKPSETDENLPLPLTDNQEKQE

mltF

Membrane-bound lytic murein transglycosylase F

484 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.511 kDa

MFDALLRYMRPVATAFVALLALLIPDNRTSHEPDAALSAILSRDFIQVFTRNTPTTYYEGRHGPTGFEYDLVRRFAESLDVSLSLNSVGNIGDVLSAVRDGRADLGAATLSLDPAEPGILYSRPIMSMQPMVIYHRGIPAPTTPEDLLGLDIAALRGSGTGRALRDLQKSLPELTWQETDELEVTDLIEMVEKGEFDAAVVYAHQFKLNRLFFPDVENGFMLGAPQSLVWAFPKDSGVALLQAANRLIDRLHASGQLDELIARYFGHDDYLEYVGARLFIRHAQARLPRYEAAFKEAARDTGFDWKLLAALGYQESHWKPRATSPTGVRGLMMLTNDTAAEVGVTNRLDPEQSIEGGATYLLHVKGRLQEEITEPDRTWMALAAYNVGLGHLYDAQKITEMQGGDPYKWADVRKALPLLQKRKWYSQVRHGYARGGEPVIYVRNIRRYYEILNYVDRSRRQFHHLGERDDTFPQTPFNTVPPVL

mltF

Membrane-bound lytic murein transglycosylase F

483 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.453 kDa

MKGLIARFIAGFALLLWAWDMVFPWQQLMQAEENRYNQIQQRKILRVGMVNHPLSYFIGAEGTAGIEYELAKSFANYLDVRLDIKTFDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASWQVVYKKGSNRPYKLSELEGDLIIPAGSAVLPILQRLKEDNPKLSWQTTNQFTQEELLLQVAEGKIPYTVGVSVDISAAQHIRPNIAVGFDLTDEAPVLWYLPNSSYSELQAAVLDFMNHANETGLISRIEEKYFNHLAHFDYVDIQSYLKAIKLVLPKYQSLFEKYCGDLEWQMLAAIAYQESHWDPNATSPTGVRGMMMLTRDTAERMKITDRTSAEQSIRAGSEYLHMLMRQIPETVPKEDRIWYGLAAYNMGLGHLLDVRRLTRQLGGNPDNWLDVKKNLPLLAEKRHYSGLKYGYARGFEAFQYVENIRRYYSSIINHQRVEEQQIQNNEEQPSVPQEISKESDSTLKE

mltF

Membrane-bound lytic murein transglycosylase F

483 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.51 kDa

MKGLIARFIAGFALLLWAWDMVFPWQQLMQAEENRYNQIQQRKILRVGMVNHPLSYFIGAEGTAGIEYELAKSFANYLDVRLDIKTFDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASWQVVYKKGSNRPYKLSELEGDLIIPAGSAVLPILQRLKEDNPKLSWQTTNQFTQEELLLQVAEGKIPYTVGISVDISAAQHIRPNIAVGFDLTDEAPVLWYLPNSSYSELQAAVLDFMNHANETGLISRIEEKYFNHLAHFDYVDIQSYLKAIKLVLPKYQSLFEKYRGDLEWQMLAAIAYQESHWDPNATSPTGVRGMMMLTRDTAERMKITDRTSAEQSIRAGSEYLHMLMRQIPETVPKEDRIWYGLAAYNMGLGHLLDVRRLTRQLGGNPDNWLDVKKNLPLLAEKRHYSGLKYGYARGFEAFQYVENIRRYYSSIINHQRVEEQQIQNNEEQSSVPQEISKESDSTLKE

mltF

Membrane-bound lytic murein transglycosylase F

483 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.554 kDa

MKGLIARFIAGFALLLWAWDMVFPWQQLMQAEENRYNQIQQRKILRVGMVNHPLSYFIGAEGTAGIEYELAKSFANYLDVRLDIKTFDNSEQLFSALKDNKVDIAAAGLLYQPELSKQFQIGSAYYSASWQVVYKKGSNRPYKLSELEGDLIIPAGSAVLPILQRLKEDNPKLSWQTTNQFTQEELLLQVAEGKIPYTVGISVDISAAQHIRPNIAVGFDLTDEAPVLWYLPNSSYSELQAAVLDFMNHANETGLISRIEEKYFNHLAHFDYVDIQSYLKAIKLVLPKYQSLFEKYRGDLEWQMLAAIAYQESHWDPNATSPTGVRGMMMLTRDTAERMKITDRTSAEQSIRAGSEYLHMLMRQIPETVPKEDRIWYGLAAYNMGFGHLLDVRRLTRQLGGNPDNWLDVKKNLPLLAEKRHYSGLKYGYARGFEAFQYVENIRRYYSSIINHQRVEEQQIQNNEEQPSVPQEISKESDSTLKE

mltF

Membrane-bound lytic murein transglycosylase F

483 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.01 kDa

MKGLVIRISVALALLLWAVDMVFPWQQIIRSEANHYEAIQERGTLVVGTINNSVSYFIDPNGNPAGLEYDLSKSFADYLGVELEIKSLDNSDALFDALQNNKIDIAAANLLHQQRYQKQFQFGPAYTSASWQLVYRKGKDKPRSLTQLSAKDKLVITQSEELLNILSAQQKKQPTLSWQINSLLSQEALLLQVAEGKIDYTIANSIDVSAAQQIKPEIAVAFDITDEADVHWYLPSSSYSELQAALLDFMNGAIENGLIARIEEKYFSHIAQFDYVDIKSYTNAIEKILPKYTALFKKYQGELDWRLLAAVAYQESHWNEDATSPTGVRGIMMLTKATADRMKINDRTDAEQSIKAGSEYLHWLISQVPNSVPQEDKIWYALTAYNMGLGHMLDVRRLTKSLGGDPDNWLEVKKNLPLLAEKQYYSKLKYGYARGYEAFQYVENIRRYMNSIINYHRVRDDQISRPLEKVTDSIMITPQNSQD

mltF

Membrane-bound lytic murein transglycosylase F

482 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.058 kDa

MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYTAIQARGSLYVGTINNQISYFINKDSERGFEYELAKAFADTLGVELEMKIFDNQEQLFDELDKHNIDLAAAHLLYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETLKELQKQYPQLTWKRNQALTQEELLLQLAEGKIPYVIANSIDIAAIQQIKPELAIAFDITDEANVHWYLPNSPYRDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYMNAIENTLPQFSPLFEKYKGELDWRLLAAVAYQESHWNPDATSPTGVRGIMMLTKNTAQHMKISDRTDPEQSIKAGSEYLHWLISQLPESIEKEERIWFALVAYNIGLGHLIDARRLTQNLGGNPDNWLNVKKNLPLLAEKRYYSQLKYGYARGYEAYQYVENIRRYMNSIVNYHRVQENQTTNDNANNESAVKNLEEIKENKD

mltF

Membrane-bound lytic murein transglycosylase F

482 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.014 kDa

MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYAAIQSRGALYVGTINNQISYFTNNDGERGFEYELAKAFADSLGVELEMKTFDNQEQLFDELDKHNIDLAAAHILYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETLKELQKQYPQLTWKRNQTLTQEELLLQLAEGKIPYVIANSIDIAAMQQIKPELAIAFDITDEANVHWYLPNKSYHDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYMNAIENTLPQYSPLFEKYQGELDWRLLAAVAYQESHWDPHATSPTGVRGIMMLTKNTAQHMKISDRTNPEQSIKAGSEYLHWLISQLPESIEKEEKIWFALVAYNIGLGHLIDARRLTQNLGGNPDNWLDVKKNLPLLAEKRYYSQLKYGYARGYEAYQYVENIRRYMNSIVNYHRVQENQIINDNASNESAVKNLEEIKENKD

mltF

Membrane-bound lytic murein transglycosylase F

482 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.082 kDa

MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYTAIQARGSLYVGTINNQISYFINKDSERGFEYELAKAFADTLGVELEMKIFDNQEQLFDELNKHNIDLAAAHLLYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETLKELQKQYPQLIWKRNQALTQEELLLQLAEGKIPYVIANSIDIAAIQQIKPELAIAFDITDEANVHWYLPNSPYRDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYMNAIENILPQFSPLFEKYKGELDWRLLAAVAYQESHWNPDATSPTGVRGIMMLTKNTAQHMKISDRTDPEQSIKAGSEYLHWLISQLPESIEKEERIWFALVAYNIGLGHLIDARRLTQNLGGNPDNWLNVKKNLPLLAEKRYYSQLKYGYARGYEAYQYVENIRRYMNSIVNYHRVQENQTTNDNANNESAVKNLEEIKENED

mltF

Membrane-bound lytic murein transglycosylase F

482 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

56.106 kDa

MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYTAIQARGSLYVGTINNQISYFINKDSERGFEYELAKAFADTLGVELEMKIFDNQEQLFDELDKHNIDLAAAHLLYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETLKELQKQYPQLIWKRNQALTQEELLLQLAEGKIPYVIANSIDIAAIQQIKPELAIAFDITDEANVHWYLPNNPYRDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYMNAIENTLPQFSPLFEKYKGELDWRLLAAVAYQESHWNPDATSPTGVRGIMMLTKNTAQHMKISDRTDPEQSIKAGSEYLHWLISQLPESIEKEERIWFALVAYNIGLGHLIDARRLTQNLGGNPDNWFDVKKNLPLLAEKRYYSQLKYGYARGYEAHQYVENIRRYMNSIVNYHRVQENQTTNDNANNESAVKNLEEIKENKD

mltF

Membrane-bound lytic murein transglycosylase F

482 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.694 kDa

MKGLFIRIVLAICLSLWAIDMVFPWQQIVRSKQNYHTTIQERQKLIVGTINNPVSYFIGTNGETGLEYELSKAFANYLNVDLEMFPLNSADALFQALAQGKIDIAAASLFYQQDRSEKFKLGPAYHAASWQLTYRKGERRPITLENLSGKLVIPANSALNNILLAKKEKYPSLTWETSELSQEELLFQVAEGKIDYTIATSTEVSVNQQIKPQIAIAFNVTDEFTVHWYLSDKGSSELQAALLDFMNSAIENGLIARIEEKYFNHLNQFDYVDTRSYLNAIETVLPKYAPLFEKYKGDLDWRLLAAISYQESHWNPEATSPTGVRGMMMLTKATADRMNITNRLDPEQSIKAGSEYLHLLLKQMPDTILKEDRIWFALAAYNMGLGHLLDVRRLTKQLGGNPDNWLEVKKNLPLLAQKRYFTHLKYGYARGYEAFQYVENIRRYMNSIMNYYRLQQNQQDRQDRYENENNDVISTQTQQEQR

mltF

Membrane-bound lytic murein transglycosylase F

481 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.428 kDa

MIRLRRVLFLLTSVLVLTACQPPGLVVDAPQPKAEAETLRVGTLYGAQIYMSSGQGLSGFDYELAQKFADYLGKPLEMQPYSNRSELYDALAKGEIDLIAAGITESPNRRNRFRMGPPLYRVDQVVVYRQGNRAPESIEQLSGNLTVVADSAFVETLTRLQQTHTNLSWEQTSEKDNDELIAMIASGELNYTLAQSTSLDINRRYMPELRSGLVLEEKVPVVWLLPAQNSDALMSKLLAFWHQEKRAGTLAHLNEKYFGHVKRFDYVDTRAFIRAIDAKLPRYRPLFEEYAGDLDWRKLAAASYQESHWNPNARSPTGVRGMMMLTNATASQLGVTNRLDPRQSIRGGADYLRDLINRLPESIPENQRMWFALAAYNIGLGHLEDARRLAEAQGLNPSAWRDVKQVLPLLQKRKFYSQTRYGYARGGEAVHYVDSIRRYYDTLVWVDNQKPKDEPQLPDEIQVEETAASSGAEPPTAAPRE

mltF

Membrane-bound lytic murein transglycosylase F

481 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.428 kDa

MIRLRRVLFLLTSVLVLTACQPPGLVVDAPQPKAEAETLRVGTLYGAQIYMSSGQGLSGFDYELAQKFADYLGKPLEMQPYSNRSELYDALAKGEIDLIAAGITESPNRRNRFRMGPPLYRVDQVVVYRQGNRAPESIEQLSGNLTVVADSAFVETLTRLQQTHTNLSWEQTSEKDNDELIAMIASGELNYTLAQSTSLDINRRYMPELRSGLVLEEKVPVVWLLPAQNSDALMSKLLAFWHQEKRAGTLAHLNEKYFGHVKRFDYVDTRAFIRAIDAKLPRYRPLFEEYAGDLDWRKLAAASYQESHWNPNARSPTGVRGMMMLTNATASQLGVTNRLDPRQSIRGGADYLRDLINRLPESIPENQRMWFALAAYNIGLGHLEDARRLAEAQGLNPSAWRDVKQVLPLLQKRKFYSQTRYGYARGGEAVHYVDSIRRYYDTLVWVDNQKPKDEPQLPDEIQVEETAASSGAEPPTAAPRE

mltF

Membrane-bound lytic murein transglycosylase F

481 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.689 kDa

MKPLKLNYFFIGIITLLLALALWPSIPWRSSQDVQLRQILSRGELRISTVNSPLTYAMSNGSPTGLDYELAKRFADYLGVKLVVSSRKNLDELFDDLDGDDADLLAAGLIYNHERLERFRAGPTYYSISQQMVYRLGSPRPKTLDKLQGRLVVTSGSAHAATLRDLKAEKYPQLSWESASDQSTQELLKQVADGKLDYTLGDSVTIGLMQRIHPQLAVAFDLSDEEPVIWYMRRSHDDSLSAALLDFFSQLVEDGTLARLEEKYLGHVGEFDYVDTTTFLSAIDETLPDLRPLFEKYATDIDWKLLAAISYQESHWNPLATSPTGVRGLMMLTRNTAESLNVTDRVDPEQSIRGGAQYMSHMMQKMPDTIPEDEKIWFALASYNMGYAHLLDARKLTEKQKGNPDSWVDVKMRLPMLSQKRYYTQTTYGYARGHEAYNYVENIRRYMVSLEGYLIEKEAKVQQQTQIALGYPAVPLTKVPE

mltF

Membrane-bound lytic murein transglycosylase F

480 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.958 kDa

MKKLLFVLLTITLLASCQKVSVEQTKVIPEPIKKTTLNVGTLYGAQIFVTTGQGEAGFDFEMASRFAEYLKLELKMKPYSNISELYQALESGEVDLLAAGLADTPTRREKFRLGPPLYRVNQVLVYKQGTPIPKDVSTLEDNITVITDSSFVETLSQLQKLYPELVWEQEKEKDSEELMAMIARGEITYTIADSSTFEINRRYLPELRAGPILKEKQAIVWLLPPKNSDQLMSDLLTFWHYEKRSGTLAHLNEKYFAHVKRFDYVDTRAFLRAIDNKLPKYKESFQHYANGIDWRKLAATAYQESHWNPNARSPTGVRGLMMLTLPTAKQVGIKNRLDPIQSIKGGAKYLNDILNRLPDSIPENQRMWFALASYNIGYGHVEDARKLAQSMGLNPSAWRDLKEVLPLLHKRKYYQRTRYGYARGNEAVHYVDSIRRYYDTLVWVDNQNQLLIDEKASAEESQLAEKIGGKQENLSGAQPQ

mltF

Membrane-bound lytic murein transglycosylase F

480 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.833 kDa

MNRILLTLLTLTLLAGCQRVAVEETKLVPPAVEKTVLNVGTIYGSQIYVTTGQGEAGFDYEMASRFADHLELELAMKPYSNIKELYQALNSGEVDLIAAGLADTPTRRENFRLGPPLYRVNQVLVYKQGTPQPKDISQLKDEITVITDSSFVDTLSQLQKIYPELVWDQEQDKDNEELLAMIARGEISYTIADSTTFEISRRYMPELRAGLTLKEKQAIVWLLPAQNSDKLMSELLTFWHGEKLDGTLAHLDEKYFAHVKRFDYVDTRAFLRAIDNKLPKYKERFQYYAGDLDWRKLAATAYQESHWNPNARSPTGVRGLMMLTLPTAKQMGIENRLDAEQSIKGGAKYLRGILNRLPDSIPDNQRMWFALASYNIGYGHVEDARKLAESMGLNPSAWRDLKEVLPLLQKRKYYKQTRYGYARGNEAVHYVDNIRRYYDTLVWIDNQNKLLEENQALIEESQLADQIGIGEKAITGAQPE

mltF

Membrane-bound lytic murein transglycosylase F

479 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

55.26 kDa

MKGLFIRIVLAICLSLWAIDMVFPWQQIVRSKQNYHTTIQERQKLIVGTINNPVSYFIGTNGETGLEYELSKAFANYLNVDLEMFPLNSADALFQALAQGKIDIAAASLFYQQDRSEKFKLGPAYHAASWQLTYRKGERRPITLENLSGKLVIPANSALNNILLAKKEKYPSLTWETSELSQEELLFQVAEGKIDYTIATSTEVSVNQQIKPQIAIAFNVTDEFTVHWYLSDKGASELQAALLDFMNSAIENGLIARIEEKYFNHLNQFDYVDTRSYLNAIETVLPKYAPLFEKYKGDLDWHLLAAISYQESHWNPEATSPTGVRGMMMLTKATADRMNITNRLDPEQSIKAGSEYLHLLLKQMPDTILKEDRIWFALAAYNMGLGHLLDVRRLTKQLGGNPDNWLEVKKNLPLLAQKRYFTHLKYGYARGYEAFQYVENIRRYMNSIMNYYRLQQNQQDRYENENNDVISTQTQQEQR

mltF

Membrane-bound lytic murein transglycosylase F

479 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.808 kDa

MKRLLLVLCYITLLAGCQKVVVEQEKTTPPLKPTQLIVGTLYGPQIYFTSGQGDSGYDYEMAERFANYLDLELKMKPFANISELYSAMHSGEIDIIAAGLADTPARREQFRLGPPLYRVNQVLVYRQGTPIPRSVDTLKGEITVTTDSSFVDTLTELQKSNPDLVWNQEKDKDAEELLTMIAAGEIPYTIADSTSLDINRRFMPELREGLVLKRKQPVVWLLPPTNSDKLMSELLSFWHIEKRSGTLAHLNEKYFAHVERFDYVDTRAFIRAIDNKLPKYQATFEKYAEGIDWRKLAATAYQESHWNPNARSPTGVRGLMMLTLPTAKQVGIKNRLDPYQSIKGGAKYLNSMLERLPDSIPESQRMWFALASYNIGLGHVEDARKLAQSQGLNPSAWRDVKSVLPLLQKRKYYQKTRYGYARGNEAVHYVDSIRRYYDTLVWIDNQNMLLELKQKPLQTAEAKETEEKPQTDAIQPQQP

mltF

Membrane-bound lytic murein transglycosylase F

478 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.437 kDa

MFPDSSYLFSMRSLSRFLIAIFGCGALLASCDSFERSVLPFDKTDELVVITVNSPDTYYENAEGSYAGLDYDLATEFAKELGMKVRFKTVPRLDKAWSLLEKHKGHFAAGMNISAKHSRHVAFGPIYQLVQPQLAYNTDYNKPKNLHQLGGRTIRIAKGVTHAEQLNKAKHEVPELKWKEMDLTPDELLARLAEGKVDYVVADSTQINLAKNFYPNLNAAFNLGDSVGRAWAFSPFAEQALLEATQKFFTRIQQDGTLTRLLDRYYGHIERLHHTDVNGILAKRRTILPELREHFYEAEELSGIDWRLIAALAYQESHWDALATSPSNVRGIMMLTEITADRMKVTDRLDARQSILAGARYFALLKDKLPTRIKEPDRTWMALAAYNQGPSHLEDARILAQKMGLSPDAWVDLKKTLPLLSQSEHFRTLRHGFARGGQAVVLAESVRIYYEILQKYEPPYSWGFPIVARKEDDSWQEF

mltF

Membrane-bound lytic murein transglycosylase F

478 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.736 kDa

MTRFLFAIILGLLLTACQQETVEETEFVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDMAVLFAEYLDVPLKMVPYTNLAELYDALKKNEIDIIAAGMTETPARREHFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKRHPTLVWDQVTDKDNEELLTMIANKEIDYTIADSSSVQINRRYLPVLRSGLVLEEKLNVVWLLPPTHSDGLMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQHFETHAGDLDWRKLAATSYQESHWNPNARSPTGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWQDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNSEEVAPSDLTAEETPVPAPGTLSPDKPK

mltF

Membrane-bound lytic murein transglycosylase F

478 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.8 kDa

MTRFLFAIILGFLLTACQQVTVEETEYVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDMAVLFAEYLDVPLKMVPYTNRAELYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPTPKDITDLKGKITVIADSSFVETLTQLQKRHPTLVWDQVTDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGLVLEEKLDVVWLLPPTHSDGLMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSYQESHWNPNARSPTGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNSDEEEPSDLASEDGPAPVPGTLSPDKPK

mltF

Membrane-bound lytic murein transglycosylase F

478 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.814 kDa

MTRFLFAIILGFLLTACQQVTVEETEYVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDMAVLFAEYLDVPLKMVPYTNRAELYEALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPTPKDITDLKGKITVIADSSFVETLTQLQKRHPTLVWDQVTDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGLVLEEKLDVVWLLPPTHSDGLMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSYQESHWNPNARSPTGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNSDEEEPSDLASEDGPAPVPGTLSPDKPK

mltF

Membrane-bound lytic murein transglycosylase F

478 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.829 kDa

MTRFLFAIILGFLLTACQQVTVEETEYVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDMAVLFAEYLDVPLKMVPYTNRAELYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPTPKDITDLKGKITVIADSSFVETLTQLQKRHPTLVWDQVTDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGLVLEEKLDVVWLLPPTHSDSLMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSYQESHWNPNARSPTGVRGMMMLTQPTAKEIGITNRLDAKESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNSDEEEPSDLASEDGPAPVPGTLSPDKPK

mltF

Membrane-bound lytic murein transglycosylase F

477 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.788 kDa

MTRFLLIIILGFLLTACQQVTVDEPEFVPHQLTELRVGTLYGPQIYMTSGQGNSGFDYDMALRFAEYLNVPLKMVPYTNRSELYDALKKNDIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGVAAPKDISKLKGRITIIADSAFVETLTQLQKHHPSLVWDQVTDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTHSDALMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSYQESHWNPHARSPTGVRGMMMLTEPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQPMPEDEQNDLIAEELPSMPAGSLSPDQPK

mltF

Membrane-bound lytic murein transglycosylase F

477 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.788 kDa

MTRFLLIIILGFLLTACQQVTVDEPEFVPHQLTELRVGTLYGPQIYMTSGQGNSGFDYDMALRFAEYLNVPLKMVPYTNRSELYDALKKNDIDIIAAGMTETPARREQFRLGPPLYRVNQVLVYREGVAAPKDISKLKGRITIIADSAFVETLTQLQKHHPSLVWDQVTDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTHSDALMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSYQESHWNPHARSPTGVRGMMMLTEPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQPMPEDEQNDLIAEELPSMPAGSLSPDQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.388 kDa

MIKTLFIILLCGILSACQPVDIQDVDIAAPAPKRTVLKVGTLYGPQIYLNSEQGESGFDFEMAQRFADYLAVPLEMIPYTNRKQLFAALKENKIDIIAAGIAKTPNRSQQFKLGPTLYKVNQVLVYKEGTPEPKDISTLSGEITVMANSSSVNTLTKLQKDYPELMWNQVNDKDNEELFALIANGELNYTISDSNSLLINQRFLPELRAGMILEEKVEVVWLLPPNNSDRLMSKLLAFWHKERRAGTLEHLNEKYFGHVKRFDYVDTRAFIRAIDNILPEYRSFFEEYSGELDWRKLAAASYQESHWNPSARSPTGVRGMMMLTQPTAAYVGVDDRLDAEQSIRGGAFYLKDMMERLPDTISEAQRIWFALASYNIGLGHVEDARRLTESMGMDPSAWRDVKKVLPLLQQSKYYKQTRYGYARGSEAVHYVDSIRRYYDTLVWIDNQTKTMEIIEEKEQVEVIAEEVPAKSHVSAQ

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.652 kDa

MTRFLFALILGFLLTACQQVTVDETEFVPKKLTELRVGTLYGPQIYMTSGQGDSGFDYDMAVLFAEYLDVPLKMVPYTNRTELYEALKKNEIDLIAAGMTETPARREQFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKITVIADSSFVETLTQLQKHYPTLVWDQITDKDSEELLAMIANKEIDYTIADSSSVQINRRYLPDLRSGPVLEEKLDVVWLLPPTRSDELMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFDYVDTRAFIRAIETVLPRYRQLFETHAGNLDWRKLAATSYQESHWNPHARSATGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLNDMINRLPESIPESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVWVDNQSKQQNPEEEPSDLASEEPAIPAGTLSPEQPK

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.388 kDa

MIKTLFIILLCGILSACQPVDIQDVDIAAPAPKRTVLKVGTLYGPQIYLNSEQGESGFDFEMAQRFADYLAVPLEMIPYTNRKQLFAALKENKIDIIAAGIAKTPNRSQQFKLGPTLYKVNQVLVYKEGTPEPKDISTLSGEITVMANSSSVNTLTKLQKDYPELMWNQVNDKDNEELFALIANGELNYTISDSNSLLINQRFLPELRAGMILEEKVEVVWLLPPNNSDRLMSKLLAFWHKERRAGTLEHLNEKYFGHVKRFDYVDTRAFIRAIDNILPEYRSFFEEYSGELDWRKLAAASYQESHWNPSARSPTGVRGMMMLTQPTAAYVGVDDRLDAEQSIRGGAFYLKDMMERLPDTISEAQRIWFALASYNIGLGHVEDARRLTESMGMDPSAWRDVKKVLPLLQQSKYYKQTRYGYARGSEAVHYVDSIRRYYDTLVWIDNQTKTMEIIEEKEQVEVIAEEVPAKSHVSAQ

mltF

Membrane-bound lytic murein transglycosylase F

476 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.6 kDa

MRSFLLILFCVSLLTGCQGERVDAAKAVETQPKTQLNVGTLYGAQIYVTTGQGLAGFDYEMAERFAKHQGLTLNMQPYPTISDLYQAMRNGEIDLIAAGLADTQSRREQFRLGPPLYYVNQVLVYKQGAKYPTDVSQLDDNITVISDSSFIETLAEMQKLYPELVWDQQWDKDSEELLAMIARDEISYTIADSTTFEINRRYMPELRAGPVLREGQAVVWLLPPNGSDQLMSDLLSFWHQEKRAGTLAHLNEKYFAHVKRFDYVDTRAFLRAIDSRLPKYRDNFVEYAGDLDWRKLAATAYQESHWNPNARSPTGVRGMMMLTLPTAKQMGIDNRLDPEQSIRGGAKYLSDILNRLPESIPENQRMWFALASYNIGYGHVEDARKLAQSMGLNPSAWRDLKKVLPLLQKRKYYKQTRYGYARGSEAVHYVDNIRRYYDTLVWIDNQNQQLQDEVMEAQQQTAEKQSQSEISAAQPN

mltF

Membrane-bound lytic murein transglycosylase F

475 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

53.647 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAV

mltF

Membrane-bound lytic murein transglycosylase F

475 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

53.647 kDa

MKKLKINYLFIGILTLLLAAALWPSIPWFGKTENHIAAIQARGVLRVSTIDSPLTYSVINGKKYGLDYELAQQFANYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYDSARVKNYQPGPMYYSVSQQLVYRVGQYRPRSLATVNENQLTIAPGHVVVNDLQRLKETKFPDLSWKVDDKKGSTTLLEEVISGKLDYTIADSVAISLFQRVHPELAVALDVTDEQPVTWFSRLDDDNTLSAALLDFFNSINEDGSLARIEEKYLGHGDDFDYVDTRSFLRAVDNVLPELEPLFKKYAKEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQSLGLTDRTDAEQSISGGARYLEDMMAKVPETVPEDERIWFALAAYNMGYAHMLDARSLTVKTKGNPDSWTDVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQEAEAMKLAQDYPAV

mltF

Membrane-bound lytic murein transglycosylase F

475 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.273 kDa

MKKLLLILCCITLLAACQKVVVEQEEPVFIPEPTELVVGTLYGPQIYFTSGQGDSGYDYEMAERFAKYLNLKLKMRAFANISELYAAMRSGEIDIIAAGLGDTPARREQFRVGPPLYRVDQVLVYRQGTPVPKNINSLNGEITVITDSSFVDTLTDLQKSNPDLVWNQEKDKDAEELLTMIAAGDIPYTIADSTSLDINRRFMPELREGLVLKKKQPVVWLLPANNSDKLMSQLLAFWHIEKRSGTLAHLNEKYFAHVKRFDYVDTRAFIRAIDNKLPKYQSTFEKYAGDIDWRKLAATAYQESHWNPNARSPTGVRGLMMLTLPTAKQVGIKNRLDPYQSIQGGAKYLNSMLERLPESIPDSQRMWFALASYNIGLGHVEDARKLAQTQGLNPSAWRDVKSVLPLLQKRKYYKKTRYGYARGNEAVHYVDSIRRYYDTLVWIDNQNMLLELKKENIQMAENLEQKTEAAQPQQP

mltF

Membrane-bound lytic murein transglycosylase F

472 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.145 kDa

MKGLLARLIIGIALLLWAWDMIFPWQRLMRAEQNHYSQVLQRQTLKVGTINHPLSYFVGANGKSGIEYELAKSFADYLGLNLMIKTFDNSEQLFTALADNKIDIAAAGLLYQPEQAQQFQIGASYYSASWQVVYKKGTTRPYKLAELQSDIVVPCGSAVIPILQHLKAKNPMLRWHTTDQFTQEELLLQVAEGKIPYTVAVSVDISSAQHISPNIAVGFDLTDEMPVVWYLPKSSYSELQASVLDFMHNANDRGLISKIEEKYFNHLIRFDYVAVQSYLNAIKTILPKYRPLFEKYKGELDWQMLAAIAYQESHWDPNATSPTGVRGIMMLTRATAERMKITDRTNAEQSIRAGSEYLHLLINQLPDTIAKEDKIWFGLAAYNMGWGHLLDVRRLTKQLGGDPDNWLDVKKNLPLLAEKRHYSGLKYGYARGFEAFQYVENIRRYYNSIVNQQRIEKQKSEQRLDNQSTEMH

mltF

Membrane-bound lytic murein transglycosylase F

472 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

53.934 kDa

MRLLVIFLLALLLMACKEAPKPLADPRTTKEIIVVTHNGPSTYYYSGNNQYAGLEHDLVRNFVRELGPEYSVKFLVVNNISQVIPTLLKHKAHFAAADLSITRTREHLVRFTRPYQKVQQQIVFNNELTKAPKNIKELLNRQIAVPSGTSYSERLQRLKEQEPLLSWTETPHANSDELMAQVAEGELDFTVADGHLIALVQNYYPNLGATLALGKPEEIAWAFPKTGDTWLYEKANAFFTRISQDGTLNHLIDRYYGHADRLKPVDVTTFMQRSETLLPQYKRLFYEAQELTGLDWRLVAAIAYQESHWDRFNTSPTNVRGMMMLTEDTADRLGVTDRLDARQSIIAGARYVLMLKDLIPDSVHEPDRTWMALAAYNIGYAHLQDARILAKRLKLNPDRWVDVKKALPLLSKEEYFSTLKYGFARGGAPVVFVESVRTYHKILARREPRHTPIFPSFEVANLNGFGNTLSQE

mltF

Membrane-bound lytic murein transglycosylase F

470 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

54.06 kDa

MLKEKLIIIITLVMLLCACDIQEQSTQLAQIKAQNKIRVGTLASASNYYQAVQGEQGFEYELSQAFADYLGVELEIVPFFNLSDMFARLQSGDLDLIASGLTYNKTRAQQYRFGPTYRTISQKLVYKQGIERPRDYDDLTGNLMVIAKSSHSLTLQKVKKSNPELNWSETEEFDEEELLQAVIDGEIDYTLADTHTLSLFRRYHPNLSIGFSITHNDPIAWMLRKSNDDSLYALLVPFFGEAKQNNQLYVLEEKYFGHVRQFNYVNTLAYIEAIKETLPKYQPWFEQYAGTLDWRLLAALSYQESMWNPRAKSPTGVRGIMMLTRNTAKQVGVTNRLEPEQNIRGGAKYLSKLIKRIPDRIPQPDRTWLALAAYNVGWGHVNDARIITKQQGASPDKWADVKKRLPLLIKKRYYRKTRYGYSRGDVAVSYVDNIRRYYDALVWLDENNAIEEKPEAPVVAPKIGDEVEAK

mltF

Membrane-bound lytic murein transglycosylase F

470 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

52.024 kDa

MPSLKTKGAAGKFASLLLVLALSACSRPAPPPETSGELRVGTRNSPATFYIGHDGETAGFEHDLILAFSRAQNWTLSWTEKSRPQALFDMLERREIHLAAAALPQAVVKDRHLISGPILFETPVHVVYRTADRAPRGVAGLAGKKLAFIIGSGHGPMLMRLKRKHPELSWAAVENVWPEELLAQLQAGKYDAVIINGMDFDAMRNFYPGLAVAFDLPYKQKIVWALSPGSSHAFRNALARFVERARSDGTIKRALERYFGHVKRLGSSDILGILQRRPQRLPDLREHFQEAQTLSGIDWRLLAAIGYQESQWNRLATSPTGVRGVMMLTGETADRMGVSDRLNARESILGGARYLALLKDALPARIAEPDRTWLALAAYNQGQGHLEDARRIAQARGGDPNSWADVKEALPYLSRGSYAKVMKYGYARGGEALRFAENIRNYYDILLRLEPEYDPLINLGRGEDGLPPPG

mltF

Membrane-bound lytic murein transglycosylase F

467 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

52.818 kDa

MTELFRHSKHLLASLALLSVLGLMLAMHPSPSAIERIMARGELVVLTRPSNTTYYEDQHGFTGMEYELAKGFADSQGVELRILESDDLSYIRYAIRKGTADIVAAGLIATPERSKSLRFSTAYQNVDVLLVRRLTSHRITDLSQLNQQTIAVSAGSSHAELLLKAQLESPELEFQEVENATPEQLLALVEDGQVDYTLINSNSYTLQRALWPDLVADYTVARDMPLSWAFNPKDDKSLYQEAQRYLTQAKADGTTAKLEDRFYGHVEQFNLYAARSFMRHLDDRLPLYEDLFKQAEEDSGFDWRLLAALAYQESLWDPQAISPTGVKGLMMLTNNTARQMGISDRTDPSQSIRAGAGYLRRTHARIPDRIPEPSRTWMALAAYNVGYGHLEDARVLTQRQGGNPDNWQDVKQRLPLLAKPAYADQLRYGTAPGGQAVAYVRHIRRYYDLLVWAENSRRRDDTLIALN

mltF

Membrane-bound lytic murein transglycosylase F

467 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

53.052 kDa

MKRGSVALFAISFFAFGWMTHALYNDAYKMIKESTLKKIKKSGALNVVLLNAPSTYYIGSDGPKGFEYDLLESYANHLGVKLNITTANTIKEALELSKNPDIHITSASLTKTPEREKEFNFGPSYFEAQEQVVCNKSLLLDGRFPSDADSLSGLRVVVGDSTSYSETIESLKKEGFDINATYTAEYSTEELISQVDTHEIDCTIIDSNIYALNQRYFKNIVLAFDISNRRQQAWILTPDSKMLKNDMYSWLNTVNQSGEMARLKDHYYSYVLFFDYYDTVMFYKRIKTRLPKYESYFKEAAVKYEIPYSALAALSYQESHWNPNAVSYTGVRGLMMLTQDTASMLGVKNRIDPQESIFGGAKHLDQMIKSVHADVTGEDRLKFALAAYNVGLGHVADAQKLAQQLGLNQNSWADLKKVLPMLSQKKYYRTLKHGYARGNEAVKYVDAIYDYRDILQKNDVEVSLTTK

mltF

Membrane-bound lytic murein transglycosylase F

466 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

52.769 kDa

MKRFKLNYFIIGLIAILLTWSLWTTVPWRNAHQDNLAAIKARGELRISTLDAPLSYYSVNNQPSGFDYDLAQRFADYLGVTLKVRVRSNLNQLFDDLENDNADILAASLIYNAERLNRFTVGPSYYSVSQQLVYRLGQPRPKNLGDLRGRLAVASGSAQITQLRQLKKKQYPQLAWEVSSDLSSRSLLEKVADGKLDYTLADSASVGLLQRVHPQLAVAFDITEEKPVTWYLRRSDSEGLSAALLDFFSQLNDNGIMARLEEKYLGHVGGFDYVDTKTFLNAIDATLPALQPLFERYAHDIDWKLLAAISYQESHWDPLATSATGVRGLMMLTRPTADSLGIGDRTNAEQSVRGGALYLSRMMQRLPDTIPEDEKIWFALAAYNMGYAHMLDARALTAKQQGNADSWVDVKLRLPMLSQPRYYKQTLYGYARGQQAYNYVENIRRYEISLVGYLQEKEKKAAQLAD

mltF

Membrane-bound lytic murein transglycosylase F

463 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

52.573 kDa

MQSQDYKKRLKLQIIIILSIAVMSCGVPNVPTALSSLLERESIRVGTVYGAGTFYNGAEGPQGFEYELLAGFADYLGVTLDLYPFYSYEVMLEQLEEGNLDIVATGDAVTPALKRRFAYGPAYQRVEQELVFQAGATRPRDLAELDSPIIAVAGSSQAHLLSNLFKRLSEEEDEAVQTQLITTEDSDSEELLQQVANGDIAYTVADSNRLALQRRRYPNLAVARTLNENMPMAWALPLQQDDSVKAALIEYFGTVHQSGWFTVLEDKYFGHIRQFDYVDSRAFNYAAESTLTQYKSLFQKYAGDLDWRLLAAMSYQESHWNSDAISRTGVRGLMMLTLATASDWNVDDRTDPEQSIRGGSRYFASLLNRIPARISEPDRTWMAMASYNIGMGHLEDARILTEQQGGNPDLWVDVKRRLPQLRQKKYYRTTRYGYARGDEALQYVENIRRYYDSLVWLDEQGKI

mltF

Membrane-bound lytic murein transglycosylase F

456 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

50.172 kDa

MKTWPSRAVSLLLLALALPVGCSEPPPPVRDPDTLATIRERGELVVLTLAGPTSLIENEDGPPSGYEVDLANAFAASLGVTARFEVAASLPDLFDALAAGDGHVAAAGLTLTPERSERLAFSPVYKSVTEQLVCRRGGVNPTRLERLPDADIVVLEGSSYEETLRAIGVTHTALRWRTRPGGSAMPLLEAVDDGQADCTIADSHLADFARRRHPELIVARNLTGEQPLAWAYDARIDGLGEALSAWFATAHADGLLEALDETWFGRFGDYDYVDVARFVRRVENRLPRYRRLFEAAADELPFEWELLAAQAYQESHWDPDAVSATGVRGLMMLTLSTAERVGIDDRTDPEQSIVGGAAYLDDLYERVPDSVTGPDRLWFALAAYNVGMGHMYDARRLAERLGRDKDSWDDLAEILPLLSDPAHYSTLRYGYARGHEPVRYVAKIREYRALLAAQDL

mltF

Membrane-bound lytic murein transglycosylase F

455 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

51.97 kDa

MPKSAVSLFAILLLAASVITACSPQTRPDAMSVVQERQVLRVGTLINPTSYYFDHDREQGFEYDLAKRFADRLGVELEMVPRFDVNDLFTMLRRGEVDIVAAGLDRTSTRAQLFRFSPPYDIISQKVVFKQGSRQRPRDLQQITDGEIVVVEGSSHHEFLKSLGDSIPTLKWRATRDHDAVELLQMVISGEVDYTITDSTALDIQRRFHPDLSVAFTVKHDQDIAWALPQGKDDSLFAAVIEYFGEIRSSGRLAHIKEQHFGHVKQFNYVTTSLFIEAVEQVLPGYIETFKEHSGSLDWRLLAAISYQESLWNPRAVSPTGVRGMMMLTLPTAKAMGVKSRLNAEQSIRGGARYLERMLNRVPARIPQPDRTWFAIAAYNIGFGHLEDARIITERQGGNPDRWVDVKKRLPLLRQKQFYRHTRYGFARGDEPVTYVGNIRRFYDTLKYLDEQGRL

mltF

Membrane-bound lytic murein transglycosylase F

454 amino acids

Murein-degrading enzyme that degrades murein glycan strands and insoluble, high-molecular weight murein sacculi, with the concomitant formation of a 1,6-anhydromuramoyl product. Lytic transglycosylases (LTs) play an integral role in the metabolism of the peptidoglycan (PG) sacculus. Their lytic action creates space within the PG sacculus to allow for its expansion as well as for the insertion of various structures such as secretion systems and flagella.

In the C-terminal section; belongs to the transglycosylase Slt family.

52.993 kDa

MRRPLRRVTVVLLWVALAIGVAWFYDYRRSMQSLWKIRQHGKIVVLTENNANSYYIYKETPMGFEYDLAKAFAGHLGVDLEVKTPGWDALFASLQRGDGDFIAASMTHTRKREQYADFSEPYLSVRQHLILHKSDHSIVTPAGLAGRTVHVREDTTYQQRLEALQADGIDLQLVLHRNTPTEELIEQVAKRQIDITVADSAIALLNRRYYPDIRIAFPIEKEQPLAWAVRKGDRGLRTEINRFFDEIKENGTFTRIYNRYYTAVDTFDYVDVKKFHQRIYTRLPRFRPLIEKAADRHGFDWQMIAAVIYQESHFDPFAQSHTGVKGLMQLTRVTAEEMGVTDRFDFEQNITAGVAYLAKLRHRFDDIEDPRTRLLFALASYNIGYGHVRDAQQIAKNMGMDPNRWQSLKEVLPLLRNREYYADTTYGYARGNEAVRYIERILTYYDILKQKKAV