mlr6791

3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase

234 amino acids

Involved in the catabolism of pyridoxal 5-phosphate (Vitamin B6). Catalyzes the decarboxylation of 3-hydroxy-2-methylpyridine-4,5-dicarboxylate to yield 3-hydroxy-2-methylpyridine-5-carboxylate. The decarboxylation proceeds by an aldolase-like mechanism in which the binding of the substrate frees Glu-73 residue from its interaction with manganese ion replacing it by an interaction with the hydroxyl group from the substrate. Glu-73 residue then provides the proton for the keto-enol tautomerization. The decarboxylation reaction is analogous to the retroaldol reaction except that it does not need a base as the carboxylate is likely to be deprotonated under the reaction conditions.

Belongs to the aldolase class II family.

25.939 kDa

MRRKVFEELVTATKILLNEGIMDTFGHISARDPEDPASFFLAQKLAPSLITVDDIQRFNLDGETSDNRPSYLERYIHSEIYKTRPDVQCVLHTHSPAVLPYCFVDTPLRPVTHMGAFIGESVPVYEIRDKHGDETDLFGGSPDVCADIAESLGSQTVVLMARHGVVNVGKSVREVVFRAFYLEQEAAALTAGLKIGNVKYLSPGEIKTAGKLVGAQIDRGWNHWSQRLRQAGLA