mlpD

Lipoprotein MlpF

149 amino acids

An outer membrane protein that may participate in pathogenesis. Some human Lyme disease patients have antibodies against this protein (PubMed:10948116). The Mlp proteins probably undergo intragenic recombination, generating new alleles (Probable).

Belongs to the Multicopy lipoprotein (Mlp) family.

16.723 kDa

MKIINILFCLFLLLLNSCNSNDNDTLKNNAQQTKSRGKRDLTQKEATPEKPKSKEELLREKLSEDQKTHLDWLKEALGNDGEFDKFLGYDESKIKSALNHIKSELDKCTGDNSEQQKSTFKQTVQGFFSGGNIDNFANNAVSNCNNGGS

mlpD

Lipoprotein MlpD

140 amino acids

An outer membrane protein that may participate in pathogenesis. Some human Lyme disease patients have antibodies against this protein (PubMed:10948116). The Mlp proteins probably undergo intragenic recombination, generating new alleles (Probable).

Belongs to the Multicopy lipoprotein (Mlp) family.

15.862 kDa

MKIINILFCLFLLMLNGCNSNDTNNSQTKSRQKRDLTQKEATQEKPKSKEELLREKLNDNQKTHLDWLKEALGNDGEFNKFLGYDESKIKSALDHIKSELDSCTGDKVENKNTFKQVVQEALKGGIDGFENTASSTCKNS