mlaB

Intermembrane phospholipid transport system binding protein MlaB

105 amino acids

Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. MlaB plays critical roles in both the assembly and activity of the complex. May act by modulating MlaF structure and stability.

12.105 kDa

MLNWDLQKNNDKITLFLFGELSRSTLLPMWQQRGVFLSASTLDKTIVEWNLSDLQHIDSAGFAALCDFLRECQKLNKTVRLVYPPKQLLTLADLFGLSDWIANFI

mlaB

Intermembrane phospholipid transport system binding protein MlaB

97 amino acids

Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane (PubMed:19383799, PubMed:27529189). MlaB plays critical roles in both the assembly and activity of the complex. May act by modulating MlaF structure and stability (PubMed:27529189).

10.68 kDa

MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR

mlaB

Intermembrane phospholipid transport system binding protein MlaB

97 amino acids

Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. MlaB plays critical roles in both the assembly and activity of the complex. May act by modulating MlaF structure and stability.

10.68 kDa

MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR