Function
Metalloprotease (PubMed:17491590, PubMed:18637819). Acts in the basement membrane to control directional migration of distal tip cells (DTCs) along the body wall basement membranes, a key step that promotes gonad morphogenesis (PubMed:10864868, PubMed:15556863, PubMed:17491590,PubMed:19104038, PubMed:24318535, PubMed:26994289). Regulates DTC migration probably by recruiting fibulin fbl-1, type IV collagen let-2 and nidogen nid-1 to the gonad basement membrane thereby promoting the remodeling of the basement membrane (PubMed:19104038). During larval development and probably upstream of basement membrane proteins fbl-1, let-2 and nid-1, regulates pharynx length, probably by regulating pharyngeal cell length (PubMed:26994289). Does not recruit fbl-1 to the pharynx basement membrane (PubMed:26994289).
Sequence
MHTFCILIPTFLVLVWTTESARREKQQSNDISFVKRKVQDGLKFSRVIKYTNETIQGMKTNFNSNKTQELSLDVLVVADFLSYQAFLEMSNGDSHRAIHNLKEYLHALFEQTKIIYDGISFGNETLHMVFAGTWIATQERDCPLWISWAEEEEERVLNEEIRRLEEKERDLNSTFVDDTFFMNSTDSDNSSTDALISSDMPKKLRKFVDITLEEMQENNSTEMTLKIDSKKAIDKFTIWLKEQTGLPRHEHAVLITKFDLISINGNSATQGMAYVGNICENGDSSSVVEDIGAGLTSLIMAHEIGHSLGALHDGAYETAECDSNDNYLMAVAVSGSADRQSFLNSRRMSNCSINSIIENLKEPTANCVKKWKTKKGKDVSQKDFIKKPGELVKITRQCQVAFGPTFIPCLHIGYFHEQSICERIWCSDGESDECQTLNYFPAFDGTECGYNMWCLEGSCVQNTKKWMDCKDINSKTCSKYSTSKLKHYCKSKDFREICCRTCAKKGKIY