mif4gd-a

MIF4G domain-containing protein A

223 amino acids

Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation (By similarity).

Belongs to the MIF4GD family.

25.95 kDa

MADSEEQEDYKMQAFDADIQNLLKTALKEPGNVDLEKAANVIADQSLRDTTFSREAGRMCYTIIQAESKQTGRTMFRSSLLNRLQVEYKNRKETRARSLQEWVCYVGFMCNVFDYLRVNNMPMLALVHPVYDCLFDLVQPESLKREEEVDCLVLQLHRVGEQLEKMNCQRMDDLFSQLRDSFLLQGGLSSLTQLLLLEMIEYRAAGWRMTDAAQNYYYSEVSD