MHF1

Protein MHF1 homolog

242 amino acids

Involved in the promotion of spontaneous somatic homologous recombination (HR) events, which is opposite to the function of FANCM in ordered HR. Only FANCM is essential for replicative repair in the absence of the endonuclease MUS81 (PubMed:24635147). Acts in the same pathway as FANCM to restrain class II meiotic crossing over (CO), and acts with FANCM during meiosis to repair interstrand cross-links (ICLs) (PubMed:24635147, PubMed:25038251). This common pathway between MHF1 and FANCM is in parallel to the pathway that involves the RECQ4A helicase (PubMed:24635147).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

27.292 kDa

MFNISYAKRNAKYLFKLLAWCMMIEEAGPNIGNKQKVVLQLSKMLIMYIILHINAAFWTWRGYLKRCVLHFVFPRIFLPLLSDSPTITQAKKPSYCFAMDVGGEDISDLQVDQIVEEYSMDDLIRDRFRLSAISIAEAEAKKNGMEIGGPVVACVADLAFKYAENVAKDLELFAHHAGRKVVNMDDVVLSAHRNDNLAASLRSLCNELKAKEPQSERKRKKGSAKKEDKASSSNAVRITTDL

MHF1

Inner kinetochore subunit MHF1

117 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (By similarity). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (By similarity). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (By similarity).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

13.282 kDa

MVKQQSKEEIALQLKSAVYLSVAKIVEAKLEDLNNDNAATTTTESNNKNNNNNMLIATPTFIAQLVELVYNQLINLGEDLELFCQHANRDIVEPSDLFMVTRKNPTLQQHLKDLLRQ

mhf1

Inner kinetochore subunit mhf1

110 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:24026537). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (Probable) (PubMed:24026537). FANCM-MHF promotes non-crossover recombination both in mitotic and meiotic cells (PubMed:22723423, PubMed:24026537). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:24026537).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

12.821 kDa

MMEEERFKAEIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEMVWEQIRVLAKDIEAFAEHAGRKTVQPQDVLLCCRRNEGLYEIINNFHKESIKSKKKKKENSTT

mhf1

Inner kinetochore subunit mhf1

110 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:24026537). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (Probable) (PubMed:24026537). FANCM-MHF promotes non-crossover recombination both in mitotic and meiotic cells (PubMed:22723423, PubMed:24026537). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:24026537).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

12.821 kDa

MMEEERFKAEIFHVTQEVCNRTASELTESESRNVIVDELFCVGVTEMVWEQIRVLAKDIEAFAEHAGRKTVQPQDVLLCCRRNEGLYEIINNFHKESIKSKKKKKENSTT

MHF1

Inner kinetochore subunit MHF1

90 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:20347428). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (By similarity). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

10.549 kDa

MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFARHAGRGVVNKSDLMLYLRKQPDLQERVTQE

MHF1

Inner kinetochore subunit MHF1

90 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:20347428). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (By similarity). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346).

Belongs to the TAF9 family. CENP-S/MHF1 subfamily.

10.549 kDa

MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFARHAGRGVVNKSDLMLYLRKQPDLQERVTQE