mfa2

Minor fimbrium anchoring subunit Mfa2

324 amino acids

Anchoring subunit of the minor fimbriae. Regulates fimbrial length (PubMed:19589838). These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome. Fimbriae of P.gingivalis are major virulence factors (Probable).

Belongs to the bacteroidetes fimbrillin superfamily. FimB/Mfa2 family.

36.862 kDa

MNKRKHMDIRRLIISLPAIMALWGGLASCDKMIYDNYDDCPRGVYVNFYSQTECAENPSYPAEVARLNVYAFDKDGILRSANVFEDVQLSAAKEWLIPLEKDGLYTIFAWGNIDDHYNIGEIKIGETTKQQVLMRLKQDGKWATNIDGTTLWYATSPVVELKNMEDGADQYIHTRANLREYTNRVTVSVDSLPHPENYEIKLASSNGSYRFDGTVAKADSTYYPGETKVVGDSTCRAFFTTLKLESGHENTLSVTHKPTGREIFRTDLVGAILSSQYAQNINLRCINDFDIRLVAHHCNCPDDTYVVVQIWINGWLIHSYEIEL

MFA2

A2-specific pheromone

38 amino acids

Mating pheromone for A2 allele.

4.03 kDa

MLSIFETVAAAAPVTVAETQQASNNENRGQPGYYCLIA

MFA2

Mating hormone A-factor 2

38 amino acids

The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A.

4.229 kDa

MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA