mfa1

Minor fimbrium subunit Mfa1

563 amino acids

Structural subunit of the minor fimbriae (PubMed:12593606, PubMed:19589838, PubMed:24118823). These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome (PubMed:11083792, PubMed:12593606, PubMed:15972485, PubMed:19589838, PubMed:23809984, PubMed:24118823, PubMed:26001707, PubMed:26437277). They play an important role in invasion of periodontal tissues and are recognized as major virulence factors. Mfa1 orthologs from different strains have highly divergent sequences, and this correlates with pathogenicity (Probable).

Belongs to the bacteroidetes fimbrillin superfamily.

60.786 kDa

MKLNKMFLVGALLSLGFASCSKEGNGPDPDNAAKSYMSMTLSMPMGSARAGDGQDQANPDYHYVGEWAGKDKIEKVSIYMVPQGGPGLVESAEDLDFGTYYENPTIDPATHNAILKPKKGIKVNSAVGKTVKVYVVLNDIAGKAKALLANVNAADFDAKFKEIIELSTQAQALGTVADGPNPATAAGKIAKKNGTTDETIMMTCLQPSDALTIEAAVSEANAIAGIKNQAKVTVERSVARAMVSTKAQSYEIKATTQIGEIAAGSVLATITDIRWVVAQGERRQYLSKKRGTVPENTWVTPGSGFVPTSSTFHTNATEYYDYAGLWEDHNTNEAVISGTQVPTLADYQLQDVTGELANALSGKFLLPNTHKSGANAASSDYKRGNTAYVLVRAKFTPKKEAFIDRGKTYSDNTAVPEYVAGEDFFVGENGQFYVSMKSVTDPKVGGVAGMKAHKYVKGKVLYYAWLNPSTTSPDSWWNSPVVRNNIYHIHIKSIKKLGFNWNPLVPDPDPSNPENPNNPDPNPDEPGTPVPTDPENPLPDQDTFMSVEVTVLPWKVHSYEVDL

mfa1

Minor fimbrium subunit Mfa1

498 amino acids

Structural subunit of the minor fimbriae (PubMed:26001707). These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome. They play an important role in invasion of periodontal tissues and are recognized as major virulence factors. Mfa1 orthologs from different strains have highly divergent sequences, and this correlates with pathogenicity (Probable).

Belongs to the bacteroidetes fimbrillin superfamily. FimA/Mfa1 family.

53.666 kDa

MKLNKMFLVGALLSLGFASCSKEGNGPAPDSSSTADTHMSVSMSLPQHNRAGDNDYNPIGEYGGVDKINDLTVYVVGDGKIDVRKLSTADLQVNQGASTTSIVTAPFQVKSGEKTVYAIVNITPKVEAALNAATNAADLKVAYEAAYAAFSDAGSEIATLVNNQDQMIMSGKPVVQTILPNVSAANASVQNKVPIIVKRAAIRASMTITQQPVNGAYEIKALRPGNVEVVIATVSDLKWSVAQYEKKYYLQQKDNALSPAASFVPASTNDYNGANGAMKHYDYSQLANRITVHQLNAPYSVTDVPNVAYKYVSETTHADNDYRKGNTTYILVKGKLKPVAAMWADGEQAAYQEGGDLFLGLVTGKFYANEANANAANPASGGAGNPRVVTYKAAAVYYYAWLNPNTLDPTTWTMSPARRNNIYNVNISKFRNIGLSGNPFVPTDPDPNNPDTPDNPDTPDPEDPDTPNPEEPLPVQKTYMVVDVTVTPWTLHNYDIEF

mfa1

Minor fimbrium subunit Mfa1

498 amino acids

Structural subunit of the minor fimbriae. These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome. They play an important role in invasion of periodontal tissues and are recognized as major virulence factors. Mfa1 orthologs from different strains have highly divergent sequences, and this correlates with pathogenicity.

Belongs to the bacteroidetes fimbrillin superfamily. FimA/Mfa1 family.

53.582 kDa

MKLNKMFLVGALLSLGFASCSKEGNGPAPDSSSTADTHMSVSMSLPQHNRAGDNDYNPIGEYGGVDKINDLTVYVVGDGKIDVRKLSTADLQVNQGASTTSIVTAPFQVKSGEKTVYAIVNITPKVEAALNAATNAADLKVAYEAAYAAFSDAGSEIATLVNNQDQMIMSGKPVVQTILANVSAANASVQNKVPIIVKRAAIRASMTITQQPVNGAYEIKALRPGNVEVGIATVSDLKWAVAQYEKKYYLQQKDNALSPAASFVPASTNDYNGANGAMKHYDYSQLANRITVHQLNAPYSVTDVPNVAYKYVSETTHADNDYRKGNTTYILVKGKLKPVAAMWADGEQAAYQEGGDLFLGLVTGKFYANEANANAANPASGGAGNPRVVTYKAAAVYYYAWLNPNTLDPTTWTMSPARRNNIYNVNISKFRNIGLSGNPFVPTDPDPNNPDTPDNPDTPDPEDPDTPNPEEPLPVQKTYMVVDVTVTPWTLHNYDIEF

MFA1

A1-specific pheromone

40 amino acids

Mating pheromone for A1 allele.

4.113 kDa

MLSIFAQTTQTSASEPQQSPTAPQGRDNGSPIGYSSCVVA

MFA1

Mating hormone A-factor 1

36 amino acids

The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A.

3.927 kDa

MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA