mev-1

Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

184 amino acids

Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Mediates resistance to enteropathogenic E.coli infection (By similarity).

Belongs to the cytochrome b560 family.

20.244 kDa

MINIPTSILCRLGARSAISRSFGTSVVTKSEAKTPIQKFGWEYLKKQRDMKRPIAPHLTIYQPQLTWMLSGFHRISGCVMAGTLLVGGLGFAVLPLDFTTFVEYIRGWNLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGVDNIGQVYKSGWLVFGVSAVIALAIVINSCQNKSKAVKTA

mev-1

Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

182 amino acids

Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (By similarity). Mediates resistance to enteropathogenic E.coli infection (PubMed:16091039).

Belongs to the cytochrome b560 family.

19.982 kDa

MINIPTAILCRLGARSSISRSFGTSIVTKSEAKTPIQKFGWEYLLKQRSKNRPIAPHLTVYQPQLTWMLSGFHRISGCVMAGTLLVGGIGFAVLPFDFTAFVDFIRSWNLPCAVTAVFKYIIAFPIIFHTLNGIRFLGFDLAKGVNNVGQIYKSGYLVSGLSAILALAIVFNSCQNKSNKTA