melk

Maternal embryonic leucine zipper kinase

676 amino acids

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation (By similarity). Also plays a role in primitive hematopoiesis, possibly by affecting the expression of genes critical for hematopoiesis.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

76.805 kDa

MPVDSTSELLKHYEVYETIGSGGFAKVKLGRHKLTGEKVAIKIMEKKDLGDDLPRVKIEIEAMKNLSHQHVCRLYHVIETTSKIYMVLEYCPGGELFDYIIAKDRLSEEETRVFFRQIISALAYVHSQGYAHRDLKPENLLIDEDHNLKLIDFGLCAKPKGGLGFELLTCCGSPAYAAPELIQGKAYIGSEADVWSMGVLLYALLCGFLPFDDDNCMVLYRKITRGKYSNPHWLSPSSILLLNQMMQVDPKRRLTVKHLLDHPWVMRGYSTPVEWHSKYPLGHIDEDCITEMAVTFKQSKQRTIQLVSEWKYDQITATYLLLLAKKRQGRPVRLRAECPVIDIVCSPLQDMQLKKSLRFTEDDDGVHPVVLGSMVFPPDCYDDENPWTPLTPKNTHTTNTPRMKLYPETTEKWNEMAYSPVIEHSRPCRQKPERRERTKENKENLAVPGTDGDVFALPAPRTPTSSRKVKSNRTVMTTPNHNNNKSSEVNKGAGSATKEGSRRREVEQQQNGQQGELNILAFSPERRSRSLDLAGCQVDSGQKRKGGKVFGSLERGLDKVITMLTPSKKRGPRDGPRKIKAQYNVTLTNQTNADQVLNQILSILPEKNVDFVQKGYTLKCHTQSDFGKVTMQFELEVCLLQKPEVVGIRRQRLKGDAWVYKHLVEDILSSSSQWSA

melk

Maternal embryonic leucine zipper kinase

652 amino acids

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Also plays a role in primitive hematopoiesis, possibly by affecting the expression of genes critical for hematopoiesis. Plays a role in cytokinesis during early development (By similarity).

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

74.276 kDa

MAVDDYEELLKYYELHETIGTGGFAKVKLASHLTTGEKVAIKIMDKESLGDDLPRVKTEIDAMKNLSHQHVCRLYHVIETPNKIFMVLEYCPGGELFDYIIAKDRLTEDEARVFFRQIVSAVAYIHSQGYAHRDLKPENLLIDEDQNLKLIDFGLCAKPKGGLDYHLMTCCGSPAYAAPELIQGKAYIGSEADIWSMGVLMYALMCGYLPFDDDNVMVLYKKIMRGKYEIPKWLSPGSVLLLSQMLQVDPKKRISVKHLLSHPWLMQGYSCPVEWQSKYPLGYVDEDCVTELSVFYKCSRTSTSRLISEWNYDHITASYLLLHSKKSHGKPVRLKRPLAVGDQPVTSFKELRPKSTLDFEEPNCGEIAYVFGSMEFSDDELFSEDFAYSCFEPHTPKEYVKGRSEFHSVDSAPSTPVVQRYARHKSEDKENCDAALGKDENVFLHPAPWTPTPRRKQNEKKGILTTPNKNSHTKEKNQSKETPTKKPITTGEELANVISPERRCRSVELDLNQAHVDSAQKKKGAKVFGSLERGLDKMITMLTPSKRKGYAREGPRKLRAHYNVTTTNIMNPEQLLNQIVKVLPSKNVDYVQKGYTLKCKTQSDFGKVTMQFELEVCQLSKSEMVGIRRQRLKGDAWVYKRLVEDILSSCKV

MELK

Maternal embryonic leucine zipper kinase

651 amino acids

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

74.642 kDa

MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

melk

Maternal embryonic leucine zipper kinase

651 amino acids

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Also plays a role in primitive hematopoiesis, possibly by affecting the expression of genes critical for hematopoiesis (By similarity). Plays a role in cytokinesis during early development.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

74.307 kDa

MAVDDYEELLKYYELHETVGTGGFAKVKLASHLITGEKVAIKIMDKESLGDDLPRVKTEIDAMKNLSHQHVCRLYHVIETPKKIFMVLEYCPGGELFDYIIAKDRLTEEEARVFFRQIVSAVAYIHSQGYAHRDLKPENLLIDEDQNLKLIDFGLCAKPKGGLDYHLMTCCGSPAYAAPELIQGKAYIGSEADIWSMGVLMYALMCGYLPFDDDNVMVLYKKIMRGKYEIPKWLSPGSVLLLSQMMQVDPKKRITVKHLLNHPWLMHGYSCPVEWQSKYPLGYIDEDCVTELSVFYKYSRTSTTRLISEWSYDHITASYLLLHSKKSHGKAVRLKHPLAVGDQAVTSFKELRPKSKLDFEEPNGEIAYVFGSMDFSDEELFSEDFTYSSFEPHTPKEYVKGRLEFNSVDSAPATPVVQRNARHKNEDKENSNTAVARDENVFLHPAPWTPTPRRKQNEKKGILTTPNKNTQTKEKNQSKETPTKKPIGTGEEFANVISPERRCRSVELDLNQAHIDSAQKKKGAKVFGSLERGLDKMITMLTPSKRKGYTREGPRKLRAHYNVTTTNIVNPEQLLNQIVRVLPSKNVDYVQKGYTLKCKTQSDFGKVTMQFELEVCQLSKSEVVGIRRQRLKGDAWVYKRLVEDILSSCKV

Melk

Maternal embryonic leucine zipper kinase

643 amino acids

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

72.729 kDa

MKDYDELLKYYELYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVEWQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARGKPARLQLLSFSCGTASTTPKSKNLSLEDMSTSDDNCVAGLIDYELCEDKLLAPKTPQVTKHLAESNHAASKSPAPGVRRAVANKLMDKENVCTPKSSVKNEEQFVFSEPKIPVSKNQYKREIPASPTRFPTPAKARAQCLREAPVRTPGNSAGADTLTTGVISPERRCRSMDVDLNQAHMEDTPKKKGTNVFGSLERGLDKVLTALTRNKKKGSARDGPRKRKLHYNVTTTRLVNPDQLLSEIMAILPKKNVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQRPDVVGIRRQRLKGDAWVYKRLVEDILSGCKM