MED28

Mediator of RNA polymerase II transcription subunit 28

190 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

21.309 kDa

MAQNDPGSGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHNRPTPPINPGMLQGPSGMQQPMGGGVPPRPGLMPGMPPGGMSPVGPMPPGQQHMLQAQQMQQLRMMGKLPPK

MED28

Mediator of RNA polymerase II transcription subunit 28

189 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 28 family.

21.079 kDa

MASNESGGGNLMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGSGMLQGPGGGMPPMGGTPPRPGMMPGMPPGAMQPGGPMQPSPHMLQAQQMQQLRMISRQMPPK

MED28

Mediator of RNA polymerase II transcription subunit 28

184 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

20.873 kDa

MASSSNVNGNLVDELEEAFQSCIHALTKEESATGVDKDEIKLEVDQTTLKFIDLARQMEAFFLQKRFLLSALKPDLLLKEENFDLKQEIARKDELIRKHYEKIESWKNLLSDQQNYNKPIQSLPPDMRGNLTGGVPGGPGMMPGGIGMPMQNSMQVQQMQAQQQQMQMLQAQQMQQQMQSMPIG

med28

Mediator of RNA polymerase II transcription subunit 28

179 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

19.697 kDa

MASSMCGMFPGQQPPGSLPPPGPGGPGQPGLLTGTPGNRGANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVEKEDASELKNELQRKEMLIQKHLAKIHHWQQVLEDINVQHKKPTELPQGPLAFLEQASANLPAPMKPN

med28

Putative mediator of RNA polymerase II transcription subunit 28

179 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

20.656 kDa

MDTNNTNNINSLENPIDLENDPNILFTELNVKLESLITFLTKNDKDNQIFVDEIIDNKVTDLLIASKELENYFISQQSKYSAEKNKIQLKQEIYKVKKEIENKDRLIERYKNKVKEWKYHFEPLYQSQNHILHSTAQGLSGIENQFSPVFTPMPNTPSILQNLSQAKPSPSLGLGSTIL

MED28

Mediator of RNA polymerase II transcription subunit 28

178 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways (By similarity).

Belongs to the Mediator complex subunit 28 family.

19.764 kDa

MAAPLGGMFSGQQPGPPQPPPGLLGQASLLQATPGVPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIKKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINMQHKKPADIPQGSLAYLEQASANIPAPMKQT

MED28

Mediator of RNA polymerase II transcription subunit 28

178 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways.

Belongs to the Mediator complex subunit 28 family.

19.52 kDa

MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT

Med28

Mediator of RNA polymerase II transcription subunit 28

178 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways (By similarity).

Belongs to the Mediator complex subunit 28 family.

19.538 kDa

MAASLGGMFTGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAFLEQASANIPAPLKQT

Med28

Mediator of RNA polymerase II transcription subunit 28

178 amino acids

May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways (By similarity). Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 28 family.

19.524 kDa

MAASLGGMFAGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAYLEQASANIPAPLKQT

med28

Mediator of RNA polymerase II transcription subunit 28

169 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

18.801 kDa

MFSAQQPGPPPPNQPGAPAGLMSTPPGAKNPSSTLVDDLESSFEACFASLVSQDYVNGTDQEEIRTGVEQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLTKLRSWQQVLEEINGQHKKTSEMPQGPLAYLEQASANIPAPMKPT

med28

Mediator of RNA polymerase II transcription subunit 28

169 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 28 family.

18.801 kDa

MFSAQQPGPPPPNQPGAPAGLMSTPPGAKNPSSTLVDDLESSFEACFASLVSQDYVNGTDQEEIRTGVEQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLTKLRSWQQVLEEINGQHKKTSEMPQGPLAYLEQASANIPAPMKPT

MED28

Mediator of RNA polymerase II transcription subunit 28

156 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 28 family.

17.961 kDa

MDYQQKPPQSSDPSPSPPDRPPGIRSPETPSNNQNNDIEDIMACVTALEAALLPCLPARELQAIDRSPHPSHQIDVERHARDFMEAAKKLQLYFMGLKREDRAPSRAESLKKDIAVMEEELKTKDELIKKHMRLFQESQKLVKEQIEKHRDELEKV