mdt-22

Mediator of RNA polymerase II transcription subunit 22

157 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

18.163 kDa

MSGVAGGASKKSSSRTMATKKLIIDEFKRRLRDNIKSLNDNFFHIIQAAKVNPDDNAYKNQTGKMTEFYTTKNEMAVRAQLMVRASDELLKLTADLKEFLILHDFHFLTHNIKQAEAQCEETLRQQSHQHNCLDSEVSNILFDLEREIAENFYLRHT

mdt-22

Mediator of RNA polymerase II transcription subunit 22

157 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

18.163 kDa

MSGVAGGASKKSSSRTMATKKLIIDEFKRRLRDNIKSLNDNFFHIIQAAKVNPDDNAYKNQTGKMTEFYTTKNEMAVRAQLMVRASDELLKLTADLKEFLILHDFHFLTHNIKQAEAQCEETLRQQSHQHNCLDSEVSNILFDLEREIAENFYLRHT

mdt-22

Mediator of RNA polymerase II transcription subunit 22

153 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

17.743 kDa

MSGNAQKKAASRSMATKKLIIDEFKRRLRDNIKSLNDNFYHIIQAAKVNPDDNAFKNQTGKMTEFYTIKNEMAVRAQLMVRASDELLRLTTDLKEFLILHDFHFLTHNIKQAESQCEDTLRQQSHLHQALDTDVSNMLFALEEEIADNFFLGH

mdt-22

Mediator of RNA polymerase II transcription subunit 22

153 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

17.743 kDa

MSGNAQKKAASRSMATKKLIIDEFKRRLRDNIKSLNDNFYHIIQAAKVNPDDNAFKNQTGKMTEFYTIKNEMAVRAQLMVRASDELLRLTTDLKEFLILHDFHFLTHNIKQAESQCEDTLRQQSHLHQALDTDVSNMLFALEEEIADNFFLGH