Function
Non-reducing polyketide synthase; part of the gene cluster that mediates the biosynthesis of monodictyphenone, a prenyl xanthone derivative (PubMed:20139316, PubMed:21351751). The pathway begins with the synthesis of atrochrysone thioester by the polyketide synthase (PKS) mdpG (PubMed:20139316). The atrochrysone carboxyl ACP thioesterase mdpF then breaks the thioester bond and releases the atrochrysone carboxylic acid from mdpG (PubMed:20139316). The atrochrysone carboxylic acid is then converted to atrochrysone which is further transformed into emodin anthrone (PubMed:20139316). The next step is performed by the anthrone oxygenase mdpH that catalyzes the oxidation of emodinanthrone to emodin (By similarity). Emodin is further modified to yield monodictyphenone via several steps involving mdpB, mdpC mdpJ, mdpK and mdpL (PubMed:20139316, PubMed:21351751).
Sequence
MSSSINILSTKLGQNIYAQTPPSQTLTLTNHLLQKNHDTLHIFFRNLNGHNHLVHNLLTRLVLGATPEQLQTAYDDDLPTQRAMPPLVPSIVERLSDNSYFESQITQIDQYTNFLRFFEAEIDRRDSWKDVVIEYVFSRSPIAEKILPLMYDGAFHSIIHLGLGVEFEQPGIIAEALAQAAAHDSFGTDYFFLTAEKRAAGRNEEGETLVNLLQKIRDTPKLVEAGRVQGLIGTMKMRKSILVNAADEIIDIASRFKVTEETLARKTAEMLNLCAYLAGASQRTKDGYEPKIDFFFMHCVTSSIFFSILGRQDWISMRDRVRLVEWKGRLDLMWYALCGVPELDFEFVRTYRGERTGTMSWKELFAIVNEQHDDGHVAKFVRALKNGQEVCGQFEDGEEFMVKGDMWLRIARMAYETTIETNMQNRWVVMAGMDGAWKDFKVQSSD