mazG

Nucleoside triphosphate pyrophosphohydrolase

325 amino acids

Required to maintain the full capacity of the mycobacterium to respond to oxidative stress via the degradation of oxidation-induced damaged nucleotides. Hydrolyzes all canonical (d)NTPs, as well as mutagenic dUTP and 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphate (8-oxo-dGTP). Also involved in the transcriptional activation of RelA in response to oxidative stress.

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

35.413 kDa

MIVVLVDPRRPTLVPVEAIEFLRGEVQYTEEMPVAVPWSLPAARSAHAGNDAPVLLSSDPNHPAVITRLAAGARLISAPDSQRGERLVDAVAMMDKLRTAGPWESEQTHDSLRRYLLEETYELLDAVRSGSVDQLREELGDLLLQVLFHARIAEDASQSPFTIDDVADTLMRKLGNRAPGVLAGESISLEDQLAQWEAAKASEKARKSVADDVHTGQPALALAQKVIQRAQKAGLPAHLIPDEITSVSVSADVDAENTLRTAVLDFIDRLRCAERAIAVARRGSNVAEQLDVTPLGVITEQEWLAHWPTAVNDSRGGSKKRKGMR

mazG

Nucleoside triphosphate pyrophosphohydrolase

324 amino acids

Required to maintain the full capacity of the mycobacteria to respond to oxidative stress via the degradation of the oxidation-induced damaged nucleotides. It hydrolyzes all canonical (d)NTPs, as well as the mutagenic dUTP and 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphate (8-oxo-dGTP). Also involved in the transcriptional activation of RelA in response to oxidative stress.

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

35.303 kDa

MIVVLVDPRRPALVPVDAVEFLTGDVQYTEEMPVKVPWSLPSARPAYDGEDAPVLLSSDPEHPVVKARLAAGDRLIAAPEPQPGERLVDAVALMDKLRTSGPWESEQTHDSLRRYLLEETYELFDAVRSGNADELREELGDVLLQVLFHARIAEDAPHHPFSIDDVADALVRKLGNRVPAVLAGESISLDEQLAQWEERKAQEKKVKARASSMDDVPTGQPALALAQKVLARVSQAGLPAELIPASLTSVSVSADTDSENELRTAVLEFMDTVREVEAAVAAGRRGEDVPEELDVAPLGVISEDEWRAYWPGAESSASEAEPEE

mazG

Nucleoside triphosphate pyrophosphohydrolase

263 amino acids

Involved in the regulation of bacterial cell survival under conditions of nutritional stress. Regulates the MazE-MazF toxin-antitoxin (TA) system that mediates programmed cell death (PCD). This is achieved by lowering the cellular concentration of (p)ppGpp produced by RelA under amino acid starvation, thus protecting the cell from the toxicity of MazF. Reduction of (p)ppGpp can be achieved by direct degradation of (p)ppGpp or by degradation of NTPs, which are substrates for (p)ppGpp synthesis by RelA (By similarity).

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

30.412 kDa

MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL

mazG

Nucleoside triphosphate pyrophosphohydrolase

263 amino acids

Involved in the regulation of bacterial cell survival under conditions of nutritional stress. Regulates the type II MazE-MazF toxin-antitoxin (TA) system which mediates programmed cell death (PCD). This is achieved by lowering the cellular concentration of (p)ppGpp produced by RelA under amino acid starvation, thus protecting the cell from the toxicity of MazF. Reduction of (p)ppGpp can be achieved by direct degradation of (p)ppGpp or by degradation of NTPs, which are substrates for (p)ppGpp synthesis by RelA.

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

30.412 kDa

MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL

mazG

Nucleoside triphosphate pyrophosphohydrolase

263 amino acids

Involved in the regulation of bacterial cell survival under conditions of nutritional stress. Regulates the MazE-MazF toxin-antitoxin (TA) system that mediates programmed cell death (PCD). This is achieved by lowering the cellular concentration of (p)ppGpp produced by RelA under amino acid starvation, thus protecting the cell from the toxicity of MazF. Reduction of (p)ppGpp can be achieved by direct degradation of (p)ppGpp or by degradation of NTPs, which are substrates for (p)ppGpp synthesis by RelA (By similarity).

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

30.52 kDa

MRYSIQDFIQLIAQLRNPNGGCPWDLKQNYESMISCLTEETYEVIEAIEKKDIPNLREELGDLLLQVVFFSQLAREDKYFAFDDVLQDVAEKIVRRHPHVFGDAKAGDETEALSRWNEMKAKEKQGKSEETSILDNVPRALPSLTRAAKLQKRCSKVGFDWEEISPVFDKVREELEEVQAEINRTSIEQNKVEEEIGDLLFATVNLARHLKCDPEDALRKANLKFERRFRAVEQAVQQQGKQVNNVPLIELDLLWDEVKKQEN

mazG

Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG

255 amino acids

Catalyzes the hydrolysis of all eight canonical ribonucleoside triphosphates (NTP) and deoxyribonucleoside triphosphates (dNTP) to their corresponding nucleoside monophosphates ((d)NMP) and PPi and subsequently hydrolyzes the resultant PPi to Pi. The NTPase activity with deoxyribonucleoside triphosphates as substrate is higher than corresponding ribonucleoside triphosphates. dGTP is the best substrate among the deoxyribonucleoside triphosphates, and GTP is the best among the ribonucleoside triphosphates.

Belongs to the nucleoside triphosphate pyrophosphohydrolase family.

29.805 kDa

MKEAGILFEELVSIMEKLRSPEGCEWDRKQTHESLKPYLIEECYELIEAIDEKNDDMMKEELGDVLLQVVFHAQIARERGAFTIEDVIRTLNEKLIRRHPHVFGDSPGYSYKQWEDIKAQEKGKKKSSRIGEINPLVPALSMARRIQENASQVGFDWKDPEGVYEKIEEELKELKEAKDPRELEEEFGDLLFSIVNLSRFLNVDPESALRKATRKFVERFKKMEELIEKDGLVLEELPIEKLDEYWEKAKGGDET