MAF1

Repressor of RNA polymerase III transcription MAF1

397 amino acids

Mediator of diverse signals that repress RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA (By similarity).

Belongs to the MAF1 family.

45.029 kDa

MKFIDELDLELVNQTLNFETSESKISGGCDIFTTKPVASDKKLYKTIDRHLESLLQENESYNAAIQQQIELENKRRDPKQAGSDCAEPAEDSPTRNANSFWEQKRRMSVSESPRADTSPLFKSQKLNDQQLKELVSHPLEVPGCKSPSNETSARGVLRRSTSAGSFENNAGSAEQQKRRTSSIGSAANGTKSPILRRSSFNRETINIGPFGPISETASRRTFAYLIGILNASYPDHDFASLKPTDFVKSSRKQLVSKFENSIIALGKQPQEWIWETINAHMDLADCVFYQYNPQESFLDDEPGHLWSLMWFMFNKKRKRVAYFYLSAFRVKNPPSTGGSVALDEYYDSNSKPELREKRRRLTIEHETNDFEGEYDLTYTSSGDGAVEDEDEDMNDAD

MAF1

Repressor of RNA polymerase III transcription MAF1

395 amino acids

Mediator of diverse signals that repress RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.

Belongs to the MAF1 family.

44.733 kDa

MKFIDELDIERVNQTLNFETNDCKIVGSCDIFTTKAVASDRKLYKTIDQHLDTILQENENYNATLQQQLAAPETNQSPCSSPFYSNRRDSNSFWEQKRRISFSEYNSNNNTNNSNGNSSNNNNYSGPNGSSPATFPKSAKLNDQNLKELVSNYDSGSMSSSSLDSSSKNDERIRRRSSSSISSFKSGKSSNNNYSSGTATNNVNKRRKSSINERPSNLSLGPFGPINEPSSRKIFAYLIAILNASYPDHDFSSVEPTDFVKTSLKTFISKFENTLYSLGRQPEEWVWEVINSHMTLSDCVLFQYSPSNSFLEDEPGYLWNLIGFLYNRKRKRVAYLYLICSRLNSSTGEVEDALAKKPQGKLIIDDGSNEYEGEYDFTYDENVIDDKSDQEESLQ

MAF1

Repressor of RNA polymerase III transcription MAF1

391 amino acids

Mediator of diverse signals that repress RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA (By similarity).

Belongs to the MAF1 family.

44.346 kDa

MKFIDELDIERVNQVLNFETIDCKIVGGCDIFTTKAVASDRKLYKTIDHHLDTILQDNESYNLALQQQIALDAEDKNERSMSPGGQRRDSSSFWEQKRRMSVSDSPIYLQHINGNLNESNGAQGEIVADLVPPIIKTSKLNDHNLKELVSNYEAGYSSSSSVESLTHKNKERRTSSLSSTGGKVDKLRADSSTANDITARSVLNDTSRTLNLGPFGPINEPSSRRTFAYLIAILNASYPDHDFSLLEPTDFKRSSIKSFIAKFENSMYSLGRKPEEWIWEVINSHMTLSDCVLYQYCPTQSFLDDEPGHLWSLIGFFFNKKRKRVAYVYLLASRLQLAVNNAIGTPDEMQNEDGTFRNNNTTSFDNNNTQFEGEYDLTYEENAIVDDDDEE

maf1

Repressor of RNA polymerase III transcription

278 amino acids

Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA (By similarity).

Belongs to the MAF1 family.

31.626 kDa

MKYIDSLQLIGLNSYLNSIDVGDALLMGELEAYSCKMAGSDKKIYRSLDKELEELSNTNSGAMNITNSNNNTNNNNNNNSNSGSSNNNNNNNNTLSVSMNSPSPTSNISVSPFGPMSNSTSRKTMIYLIQLLNLSFPDYDFTDSKPEQFQKEPSLNLVINSINANLAGYIKDYYLEFEAKLWSTLESEISLQKCEIYLYKPENGDPFTENGVLFSFNYFFYNKSLKKIIFFKCRYISKLQILNDDGSDVKDPLPDQEELDDYYREYYDGDTIDNMEMS

Maf1

Repressor of RNA polymerase III transcription MAF1 homolog

260 amino acids

Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (By similarity). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation (By similarity). Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB. When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout. Additionally, may also regulate RNA polymerase I and RNA polymerase II-dependent transcription through its ability to regulate expression of the central initiation factor TBP (By similarity).

Belongs to the MAF1 family.

28.922 kDa

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVREDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNALDLELGAEEVDEESGGGGGGGEGRAEETSTMEEDRVPVICM

MAF1

Repressor of RNA polymerase III transcription MAF1 homolog

260 amino acids

Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (By similarity). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation (By similarity). Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB. When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout. Additionally, may also regulate RNA polymerase I and RNA polymerase II-dependent transcription through its ability to regulate expression of the central initiation factor TBP (By similarity).

Belongs to the MAF1 family.

29.054 kDa

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLFSAVREDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDMELGEEDEEEEEESGGGGSEGGPEEPGTMEEDRVPVICM

Maf1

Repressor of RNA polymerase III transcription MAF1 homolog

258 amino acids

Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (By similarity). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation (PubMed:30110641). Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB. When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout. Additionally, may also regulate RNA polymerase I and RNA polymerase II-dependent transcription through its ability to regulate expression of the central initiation factor TBP (By similarity).

Belongs to the MAF1 family.

28.78 kDa

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVREDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNALDLELGAEEADEESGGGGGEGRAEETSTMEEDRVPVICM

MAF1

Repressor of RNA polymerase III transcription MAF1 homolog

256 amino acids

Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (PubMed:18377933, PubMed:20233713, PubMed:20516213, PubMed:20543138). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation (By similarity). Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB (PubMed:20887893, PubMed:17505538). When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout (PubMed:26941251). Additionally, may also regulate RNA polymerase I and RNA polymerase II-dependent transcription through its ability to regulate expression of the central initiation factor TBP (PubMed:17499043).

Belongs to the MAF1 family.

28.771 kDa

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLFSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDMELGEEEVEEESRSGGSGAEETSTMEEDRVPVICI

maf1

Repressor of RNA polymerase III transcription MAF1 homolog

247 amino acids

Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA (By similarity).

Belongs to the MAF1 family.

27.874 kDa

MKLLENSSFEAINSLLTIETGDCKIIGRIESYSCKMAGDDKQMFKQFCQEGQPHVLEALSPPQSSGISPNKLSHSLDDGEGPLSDKCSRKTLFYLIATLNESFRPDYDFSRTKGHDFSKEPSVNWVFNAVNSSLSAAAGEAYSHLQPQLWEALDKEISLAECDIYSYNPDLDSDPYGEEGNLWSFNYFFYNKRLKRIVFFTCRSVSLFMAPRDSGIGTELDLELDEGSYEEEEEGNMDEERYGALCA

maf1

Repressor of RNA polymerase III transcription MAF1 homolog

245 amino acids

Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA (By similarity).

Belongs to the MAF1 family.

27.567 kDa

MKLLENSHFEAVNSQLCVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTGISPSRLGKSQGADEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSAARAHEFSREPSLNWVVNAVNSSLVSALGDDFTSLRPNLWDAVDEEINLSECDIYSYNPDLDCDPFGEDGNLWSFNYFFYNKKLKRIVFFSCRSISGYTYTHCDAGAELDMDLEEEDDEDEPSSAAGDRPQLMCI

maf1

Repressor of RNA polymerase III transcription maf1

238 amino acids

Mediator of diverse signals that repress RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.

Belongs to the MAF1 family.

26.97 kDa

MKFLELADLDTVNNALSFDADDCRIRGKCELYTTKSTNSDKKLFKAIENRCQEDLFALSSSKSPEYAFSLTQQSPFGPLDQSSSRRTFMYIVATLNASYPDHDFSSLQPTDFYKEPSLSRVVDSVNSTLNNIGRGRLSVNGIWEIIDRHINLSDCSVYSYTPDSDSDPYGDDALIWGMSYFFFNKNMKRMLYLSLHGLGKEVSGRNRYGNDDDSVFTPLADDAEPSDFDDDWVANMDD

maf1

dTTP/UTP pyrophosphatase

207 amino acids

Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.

Belongs to the Maf family. YhdE subfamily.

22.658 kDa

MTNSKQKLVLASGSPRRLELLHQIGIEPARLMPMDIDETPVKLEHPRTLCRRLSQQKAEAAQAALKSEQAWKDAYVLGSDTVVAVGRRIVGKAEYTEEASAALHLLSGRSHWVYTGICLVTPDGKIRQKVAETKVRFKRLSTREIDAYIASGQWRGKAGAYGIQGIAGAFVQKLTGSYTNVVGLPLYETMSLLSGEGFEVTSGWLEG

MAF1

MFP1 attachment factor 1

152 amino acids

16.181 kDa

MAEIDSAQSQETVTQETQNKPMTTSFSIWPPTQRTRDAVINRLIESLSTPSILSKRYGTLPQDEASETARLIEEEAFAAAGSTASDADDGIEILQVYSKEISKRMIDTVKSRSAPAAASEGESKPSELPADASEPSSASGLTGEVSSVETEP