Protein
Transcription termination factor 5, mitochondrial
Organism
Drosophila melanogaster
Function
Binds promoter DNA and regulates initiation of transcription (PubMed:22784680, PubMed:24068965). Regulates mitochondrial replication and transcription (PubMed:22784680, PubMed:24068965). Required for normal topology and maintenance of mitochondrial DNA (mtDNA) levels (PubMed:22784680, PubMed:24068965). Regulates mtDNA replication by re-activating replication after replication pausing (PubMed:24068965). Likely to regulate replication pausing by coordinating with the mitochondrial termination factor mTTF which promotes replication pausing (PubMed:24068965). Their function in replication pausing prevents unregulated replication that may occur for example by collisions between the machineries of DNA replication and transcription during mtDNA synthesis (PubMed:24068965). This ensures the incorporation of RNA transcripts into replication intermediates at the replication fork and allows for proper fork progression (PubMed:24068965). Possibly functions downstream of Dref which activates genes involved in mtDNA replication and maintenance (PubMed:24068965).
Similarity
Belongs to the mTERF family.
Sequence
MLRNGQNQAQLLARSLGQLARGMASSKRVSSKKEDLKPKLPKPPTVEIPMEEPLNASYLSKTLGSSYRSWAAALEKHPELKTLKRKDLLSSYDTLKSLDYSVDDIIAKPMIIYYGATTLANRHSVLQECGFHNVTVQTLAKYVTVVNKPIEVLKAHNYIPFDVKVAERLAGYFKDIKLPVDLRELESETLTLKSLRQSLINAYLRERLQMDDNDLQKLWRVYTRIRHKSFRAVQDTIELLTKEFNFSAERLRKNSFLLYSEADNVRRILREVPTIDSQDIREIGFRRPKILMSTCDSLKQTLQHVHAFGISEDAVLRCLEVLTLGPDTVLERLRDLQEIEEFQVLGTNPRILRLVHYQNKARLRLDYLNQLRVRCASLHILSCGSEAFAKFARDGSDRTKGRDIVVYLSNVLGKDVQVLRNLLSRHPNWCHIPLLHVKQCLEYLRSKKFKLNEIFANIHLLLYPIKRIEEKMLLLQSPDAQEDLQLPVANFDSLSNNEILTLILYLIESEFHFTGDGIWTEQHTHHVENFNNLLPDFPESLNKVYKYGVKPAEKMIMERL