Function
Transcription termination factor (PubMed:12626700, PubMed:15845400, PubMed:16648357). Binds promoter DNA and regulates mitochondrial replication and transcription (PubMed:12626700, PubMed:15845400, PubMed:16648357, PubMed:24068965). Transcription termination activity may be polarized with highest termination activity occurring when its DNA-binding site is positioned in the reverse orientation with respect to the incoming RNA polymerase (PubMed:15845400). Required for normal topology and maintenance of mitochondrial DNA (mtDNA) levels (PubMed:24068965). Regulates mtDNA replication by promoting replication pausing, possibly by acting as a natural barrier to replication fork progression (PubMed:24068965). Its function in replication pausing prevents unregulated replication that may occur for example by collisions between the machineries of DNA replication and transcription during mtDNA synthesis (PubMed:24068965). This ensures the incorporation of RNA transcripts into replication intermediates at the replication fork and allow for proper fork progression (PubMed:24068965). Shares mtDNA binding sites with the mitochondrial termination factor mTerf5 and thereby may antagonize mTerf5 function during replication to regulate pausing (PubMed:22784680, PubMed:24068965). Likely to function downstream of Dref which activates genes involved in mtDNA replication and maintenance (PubMed:19032147, PubMed:24068965).
Sequence
MIRSLLRSFETALKLHAGLNMHPMHCSRRLLFSQYENRASPSRLTSSGTLGSNEAENDYVPYRQDRETGTKTRVLLEALRERFRFTDAELQKIISDELVHRCYRGRSLTLVMDTLQLEGVSRRSFVEYPWLLSLDNKRLELKMQLLKSMDFKDINHFVPFLRLTVPRLRKLVGALNSERDAMPQRNRVYYISEKLDVSPDIVSKYLSKRLFILEMPFEMFEKNLQHMIDYNVSPINVLKDLWAFRYTPKSVQLRLERAKRAKKDKIMPWMVRCPEPILQRSLKLSLDELKVLGEFSSVVEYLAHRLGFSTSEAKAIMDKHPQVHTVRVTKIKEVLDYLLDEAQFTRFEVAQNPRILCHSLKTTKERMEELKSHGCRPSSLVILCRSRREYDKFLQNWISHERNPQSVSEG