lysB

Probable spanin, inner membrane subunit

141 amino acids

Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit. The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. Host outer membrane disruption is possibly due to local fusion between the inner and outer membrane performed by the spanin complex (By similarity).

15.811 kDa

MSRLMIVLVVLLSLAVAGLFLVKHKNASLRASLDRANNVASGQQTTITMLKNQLHVALTRADKNELAQVALRQELENAAKREAQREKTITRLLNENEDFRRWYGADLPDAVRRLHQRPACTDASDCPQRMPESEPLPDAGQ

LysB

Lysozyme B

140 amino acids

Unlikely to play an active role in the humoral immune defense. May have a function in the digestion of bacteria in the food.

Belongs to the glycosyl hydrolase 22 family.

15.612 kDa

MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCF