lpxf

Lipid A 4'-phosphatase

257 amino acids

Probably removes the 4'-phosphate moiety from lipid A species. Not seen to act on other membrane components, nor does it dephosphorylate the 1-phosphate group of lipid A and/or lipid A precursors.

Belongs to the lipid A LpxF 4'-phosphatase family.

28.363 kDa

MTAFSKHRWRGPVIRRPKTTFGAFLLLFWTWWALLAVFRAFPGIDIYFSQLFFLGTDCDATAAAGSICGGFPYRDSGNFDLLRTIFFRLPYVVAIVMAWKLIECYQQHGATFNAERARKLKVGLGALLIGPVLLVNVILKEHWGRPRPVQTDIFGGALHFVEAGSLAGKCVSNCSFVSGEAASAGWLFCLLLFVPKSLRYALVPPVAAISILTPAMRLSFGAHYLSDVTLGWLSSLVVFAALLALTESQQHQKNSEI

lpxF

Lipid A 4'-phosphatase

236 amino acids

Removes the 4'-phosphate group from lipid A species. Absence of phosphate groups in lipid A renders the bacteria resistant to host-derived cationic antimicrobial peptides (CAMP) and allows it to camouflage itself from the host innate immune response (PubMed:19552698, PubMed:20657724). Removal of the 4'-phosphate may be required to generate the substrate for deacylation of the pentaacyl lipid A to the tetraccylated lipid A species (PubMed:19552698).

Belongs to the lipid A LpxF 4'-phosphatase family.

27.362 kDa

MEYILEVERNLFLTLNGVQHPLLDGFFYLISAKWTWVIMSIAFLFFLFYKKPTKEALFIVGAVLLSVLICDQLSSSFFKPFFARFRPSHHPDFIDYVKTVYGYRGGKYGFISGHTTNYISLALFTSRIFRNKFYTWTIWSVVALVIYSRIYIGVHFITDIIPGIAVGLIVGHFVYKVYLYARSRWLGASCPAHPSAVYAGDSIRLWTLSLIGFVFAMLCMSRQLTEILQYYVFLLF

lpxF

Lipid A 4'-phosphatase

233 amino acids

Removes the 4'-phosphate moiety from lipid IV(A) (a tetraacylated precursor of lipid A).

Belongs to the lipid A LpxF 4'-phosphatase family.

25.479 kDa

MLLFWMWWALLAVFRAFPGIDIYFSQLFFVGADCDATAAAGNICGGFPYRDVAAFDLLRTVFFRLPYVVAIVMVWKLVECYQQHGATFNAERAQKLKVALGTLLIGPVLLVNVVLKEHWGRPRPIQTDIFGGALHFAEAGSLAGKCVSNCSFVSGEAASAGWLFCLLLFVPKSLRYAVAAPLAAISILTPAMRLSFGAHYLSDVVLGWLSSLVVFAALLALTESQQHQKNSEI

lpxF

Lipid A 4'-phosphatase

225 amino acids

Probably removes the 4'-phosphate group from lipid A. Removal of this phosphate group confers resistance to cationic antimicrobial peptides (CAMPs), inflammation-associated peptides produced by the human host. This LPS modification helps maintain the stability of this commensal bacterium in gut microbiota.

Belongs to the lipid A LpxF 4'-phosphatase family.

25.23 kDa

MIEFLSDIDTQLLLFFNGIHSPFWDYFMSAFTGKVIWVPMYASILYILLKNFHWKVALCYVVAIALTITFADQMCNSFLRPLVGRLRPSNPENPIADLVYIVNGRRGGGFGFPSCHAANSFGLAIFLICLFRKRWLSIFIVLWAFTNSYTRLYLGLHYPGDLVAGAIIGGFGGWLFYFIAHKLTARLQSDTPVPGKGAGMKQTEVMIYTGLLTLAGIIIYSIVQS

lpxF

Lipid A 4'-phosphatase

222 amino acids

Removes the 4'-phosphate moiety from lipid IV(A) (a tetraacylated precursor of lipid A) and from pentaacylated lipid A, but not from hexaacylated lipid A (as is found in E.coli). Does not dephosphorylate phosphatidic acid, phosphatidylglycerophosphate, or the 1-phosphate group of lipid A and lipid A precursors. Its expression in E.coli confers resistance to the cationic antimicrobial peptide (CAMP) polymyxin B (PubMed:16467300). Plays a critical role in the ability of the bacteria to avoid the host's innate immune system, especially the bactericidal action of CAMPs, although whether it is CAMP-sensitivity or increased sensitivity to the immune system is not clear (PubMed:17360489).

Belongs to the lipid A LpxF 4'-phosphatase family.

25.552 kDa

MARFHIILGLVVCFFAWIFFLIFPNLDIQFAGHFYNSSAHQFIGGYDGFLGFLHWFARFFPIFFSIIVILFLLGSLFIDKFKIKYRKAIFFIAVCLWIGPGLVVNYVFKDHWGRPRPVMVEQFNGDKIFQPPFVISSQCDKNCSFVCGDASMGFWLFAFMPLLATRKKKLVAFIAAVVAGGGLGLMRMSQGGHFFSDVVFCGIFVYISTWVVYALMYRKKEY

lpxF

Lipid A 4'-phosphatase

198 amino acids

Removes the 4'-phosphate group from tetra- and hexaacylated lipid A species, has no 1-phosphatase or Kdo hydrolase activity. Absence of the 4'-phosphate group renders the bacteria resistant to host-derived cationic antimicrobial peptides (CAMP), allowing it to camouflage itself from the host innate immune response, and plays a critical role in the long-term colonization of the host's stomach.

Belongs to the lipid A LpxF 4'-phosphatase family.

21.864 kDa

MKKLKGLFLSLLLWVYPLKSEPINEGAYILEEIGDVLRFLPIFVGTVSLAMRDYRGLGELAVGTLVTQGVIYGLKGAFSTAHKDGARVGFAKRPCCNSWRGMPSGHAGGAFSAAGFVYYRYGWKPALPVIALAILTDTSRVVAGQHTILQVTIGSLIAWGFAYLFTSRYKPKRWMLYPEISSDFKGSSRYGVGFSYQW