ldrD

Small toxic polypeptide LdrD

35 amino acids

Toxic component of a type I toxin-antitoxin (TA) system. Overexpression causes rapid cell killing and nucleoid condensation of the host cell (PubMed:12123448). Overexpression induces stress-response and a number of membrane protein genes. May inhibit ATP synthesis due to its insertion in the cell inner membrane (By similarity).

Belongs to the Ldr toxic peptide family.

3.917 kDa

MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK