khtU

K(+)/H(+) antiporter subunit KhtU

405 amino acids

Potassium/proton antiporter that mediates the efflux of potassium ions from the cell (PubMed:17679694). Can also mediate rubidium/proton antiport, but has no permeability for sodium or lithium ions. In the absence of KhtT, does not have antiport activity, but can catalyze potassium efflux (PubMed:14987767, PubMed:17679694). Involved in protection of the cell from methylglyoxal, a toxic by-product of glycolysis, via activation by S-lactoyl-BSH of the antiporter activity, leading to cytoplasmic acidification and methylglyoxal resistance (PubMed:24330391).

Belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter (TC 2.A.37) family.

43.637 kDa

MDHLVFEVGTALVLVAIASVIANKIKFSIIPFLIVLGMLVGPHAPKMGIIDLTFIQSSEIIEFFGRMGVLFLLFYLGLEFSVGKLIKSGKSIAVGGTIYILINFSLGLLYGFITGFSFLEVLILAGVITISSSAIVAKVLVDLKRTANPETELILGIIMFEDIFLAVYLSVVSGLILGDATSVGSALLSILIAFGYMLLFFIAARKLPPLLNKLLDIRSNEVFIIVIFAALFFIAGFSETIHVAEAIGALLLGLVFSETEHSDRIEHLVVPFRDFFGAMFFFSFGLSIDPFSLGEAVWLALGAVILTILGNFIAGMVAGRRAGLSHKASSNIGLTIVSRGEFSIIVANLGIAGGLSATLKPFAALYVLILAILGPLVTKESKRIYRLLNKVFKWKPEVQPAKKQG