Function
Mitogen-activated protein kinase which is an essential component of the JNK pathway composed of mlk-1, mek-1 and kgb-1 (PubMed:15116070, PubMed:22554143, PubMed:23352664). Phosphorylates the transcription factor fos-1 which prevents fos-1 dimerization and promoter binding and results in activation of target genes including F53A9.2/kreg-1 and lys-3/kreg-2 (PubMed:23437011). Phosphorylates jun-1 and activates the AP-1 transcription factor which is a heterodimer of jun-1 and fos-1 (PubMed:23352664). Phosphorylates glh-1 in vitro which may play a role in controlling glh-1 protein levels in the germline by targeting it for degradation by the proteasome (PubMed:17699606). Required for oogenesis and probably also for spermatogenesis (PubMed:12435362). Involved in the response to environmental stress such as heavy metals, infection and protein folding stress in an age-dependent manner (PubMed:15116070, PubMed:22554143). In larvae, has a protective role which becomes detrimental in adults (PubMed:22554143). May control susceptibility to infection, heavy metal stress and premature lethality by regulating daf-16 cellular localization (PubMed:22554143). Involved in the transcriptional response to bacterial pore-forming toxins and to fasting (PubMed:15256590, PubMed:21408619, PubMed:23352664). Required for fasting-induced longevity (PubMed:23352664). Involved in axon regeneration after injury downstream of tyrosine receptor svh-2 (PubMed:21670305, PubMed:22388962).
Sequence
MEVDLPVHNEYDASRFHQVTIRDPIAGADSTFTIPTRYVNLSFLNAGAQGTVVMADDLVTTQRVAIKKMQQPFVMTMSAKRAYREFILLTTIKHPNIIRLLNAFTPDTSLSTFREVYLVMELMTHNLHEVIHRLRLDHKTLSFFVYQSLCAIKHLHNSGVIHRDLKPSNIVVNDRCVLKVLDFGLARKKNVDTSMRMSDYVVTRYYRAPEVILGLPYSEKVDIWSVGCIFAEMINHTVLFPGKDRIDQWTKIYSVLGTPDDHFISQLGQSAAMYVRSLPRHQARAFSEIVPDTNFLPETENPRVHLTPHVARDLLFNMLKINPEERYSVEDALNHPYVKLWFKDDEVNAPASENRYDQEIDFADKTLIEWKELIFNEVQRYQADHDIFTG