kdelr3

ER lumen protein-retaining receptor 3

215 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum.

Belongs to the ERD2 family.

24.825 kDa

MNIFRLSGDVCHLIAIIILFLKIWRSKSCAGISGKSQVLFALVFTTRYLDLFTSYISAYNTVMKVVYLLLAYSTVGLIFFRFRNSYDSESDSFRVEFLLVPVAGLSFLENYAFTPLEILWTFSIYLESVAILPQLFMITKTGEAESITAHYLLFLGLYRALYLANWLWRFHTEGFYDQIAVVSGVVQTIFYCDFFYLYFTRVLRGSGKMSLPMPV

KDELR3

ER lumen protein-retaining receptor 3

214 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum.

Belongs to the ERD2 family.

25.027 kDa

MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPMPI

Kdelr3

ER lumen protein-retaining receptor 3

214 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum.

Belongs to the ERD2 family.

25.111 kDa

MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKVVFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQISVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPVPV

kdelr3

ER lumen protein-retaining receptor 3

214 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum.

Belongs to the ERD2 family.

25.01 kDa

MNIFRILGDVSHLLAIIILLLKMWKSKSCAGISGKSQLLFALVFTTRYLDLFTVFISPYNTVMKIIFLACAYVTVYLIYGKLRKSYDSENDTFRLEFLLVPVIGLSFLENYEFTPLEILWTFSIYLESVAILPQLFMISKTGEAESITTHYLFFLGLYRVLYLANWIWRYHTEKFYDQIAVVSGVVQTIFYFDFFYLYVTKVLKGKKLSLPMPV

kdelr3

ER lumen protein-retaining receptor 3

214 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum.

Belongs to the ERD2 family.

24.99 kDa

MNVFRISGDVSHLLAIIILLLKMWKSKSCAGISGKSQLLFALVFTTRYLDLFTVFISAYNTVMKIVFLVCAYVTVYLIYGKFRKAYDSENDTFRLEFLLVPVIGLSFLENYEFTPLEILWTFSIYLESVAILPQLFMISKTGEAESITTHYLFFLGLYRVLYLANWIWRYHTEKFYDQIAVVSGVVQTIFYFDFFYLYITKVLKGKKLSLPMPV