kaiA

Circadian clock protein KaiA

299 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

34.921 kDa

MTLSQTAVSRPQIFICTLLSSESLVDLYTQILEGDRYSLVHATYDNFLEIVEQGKHRIDCLIFEKNAALPKVVSHLHREAILLPAVLLQVEESVEKTSQPNSADRDPQQDSYYHIAEVIVDHDQEDILSSIDCAIAQFLQLSKACRLPTRLQKKYADEAIQDNLATQQQRLSQKLKERLGYLGVYYKRNPQQFFHKLTEEEQTDYLVTLKRDYRDIILNYFRQDSSVNQEIDDFVTQIFFADISILKILEIHMELMDAFAKKLKLEGRNEDILLDYRLTLIDIMAHLCEMYRRSIPKTR

kaiA

Circadian clock protein KaiA

299 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

34.717 kDa

MVSKLSLYLVTPPGFQPGKIEAQLIGDRYQIKLLDYGQKFLAFLEANKEQIDCLVVVQGKENQDYFECLTQSGILLPCVFLGPTTACEISQEDVSEQLYHSAEKYLDFANLENLSLTIDQAIAQFLHLAPSCALSDKPQDPHHSDPDKTHQAFLLLQQRRLAEKLRERLGYLGVYYKRNPKYFYRSLSPEEQQEFREQFVADYRDIVLSYFSGDLPTNQAIDQFVNQAFFADVSVSYILETHMKLMDEFAQQLKLEGRSEEILLDYRLTLIDIVAHLCEMYRRSIPREDLPFELLFRID

kaiA

Circadian clock protein KaiA

299 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

34.894 kDa

MQSPLSLCLFAPEHVAHRLRSIFQGDRHYLSTFQALDDFCAFLEDKPERIDCLLVYYEANSLPVLNRLYEQGRLLPIILLEPSPSALAKTTDEHPTIVYHNAEIHLPESQWSELPTVVDRAIAHYLHLGPICTLPNQTETIPAPIVDESSQSFLLLQQRRLADKLKERLGYLGVYYKRKPSHFYRNFSPQEKQEYLEDLSSQYREIILSYFSDEGTVNDLLDQFVNQAFFADLAISQILEIHMELMDEFSQHLKLEGRSEEVLLDYRLVLIDILAHLGEMYRRSIPREDIPFDVYYQTD

kaiA

Circadian clock protein KaiA

296 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

33.387 kDa

MARPGLTIALLLTTPNLVDACQQWLPDTRYHSIVLSGPHQGQEQLDLVSTLEAQQEEIDAVVVEQQLLDASSRDQLLGRGLLFPAVVVGEMKGHVDYHAEELHLAEDQLAQLGYTVDAAISRFLRQGRADGRSDDDGLASVDKLSRRLQERLGYLGVFYKRDPSRFLGSLPTEERRELLESLQRTYRDLLISYFSDPAASNQALESFVNTAFFSDLPITRTVDIHVDQIDEFWKQLRLEGNKSEFLQDYRLALLDVMAHLCEMYRRSIPPDIPLSGLASGRHRREADLPDAPEVSS

kaiA

Circadian clock protein KaiA

284 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation.

32.632 kDa

MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET

kaiA

Circadian clock protein KaiA

283 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation.

32.368 kDa

MAQSTALTICGLVYSPAIGQELVRLHTSDIDELVYFSSEREFCNYLEARRNSIACLILEWGEGTPQIITYLHHSATLLPAILIFPAAPAPPPAGPHYHIAEVILTTDQLDQLNRQIEEAITGFVKLCPGCAVPPHVLFRLPALKESSNVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV

kaiA

Circadian clock protein KaiA

283 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

32.354 kDa

MAQSTALTICGLVYSPAIGQELVRLHTSDIDELVYFSSEREFCNYLEARRNSVACLILEWGEGTPQIITYLHHSATLLPAILIFPAAPAPPPAGPHYHIAEVILTTDQLDQLNRQIEEAITGFVKLCPGCAVPPHVLFRLPALKESSNVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV

kaiA

Circadian clock protein KaiA

102 amino acids

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-nonspecific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it enhances the phosphorylation status of KaiC. In contrast, the presence of KaiB in the complex decreases the phosphorylation status of KaiC, suggesting that KaiB acts by antagonizing the interaction between KaiA and KaiC. A KaiA dimer is sufficient to enhance KaiC hexamer phosphorylation (By similarity).

11.965 kDa

MTQEVDQQILLQQLKSDYRQILLSYFTTDKALKEKIDKFINAVFCANIPVPEIIEIHMELIDEFSKQLRLEGRGDETLMDYRLTLIDILAHLCEAYRGAIFK