irrE

Radiation response metalloprotease IrrE

328 amino acids

Plays a central regulatory role in DNA repair and protection pathways in response to radiation stress (PubMed:12804570, PubMed:22051194). Acts as a site-specific metalloprotease that cleaves and inactivates the repressor protein DdrO, resulting in induced expression of genes required for DNA repair and cell survival after exposure to radiation (By similarity). Regulates the expression of dozens of proteins from different pathways, including the important DNA repair proteins RecA and PprA (PubMed:12399492, PubMed:12804570, PubMed:22051194). Binds to the promoters of recA and pprA (PubMed:22051194).

34.757 kDa

MPSANVSPPCPSGVRGGGMGPKAKAEASKPHPQIPVKLPFVTAPDALAAAKARMRDLAAAYVAALPGRDTHSLMAGVPGVDLKFMPLGWRDGAFDPEHNVILINSAARPERQRFTLAHEIGHAILLGDDDLLSDIHDAYEGERLEQVIETLCNVAAAAILMPEPVIAEMLERFGPTGRALAELAKRAEVSASSALYALTEQTPVPVIYAVCAPGKPPREQAASDEDAGPSTEKVLTVRASSSTRGVKYTLASGTPVPADHPAALALATGMEVREESYVPFRSGRKMKAEVDAYPSRGIVAVSFEFDPARLGRKDSEQADRDEPQDAAQ

irrE

Radiation response metalloprotease IrrE

328 amino acids

Plays a central regulatory role in DNA repair and protection pathways in response to radiation stress (PubMed:12804570, PubMed:22051194). Acts as a site-specific metalloprotease that cleaves and inactivates the repressor protein DdrO, resulting in induced expression of genes required for DNA repair and cell survival after exposure to radiation (By similarity). Regulates the expression of dozens of proteins from different pathways, including the important DNA repair proteins RecA and PprA (PubMed:12399492, PubMed:12804570, PubMed:22051194). Binds to the promoters of recA and pprA (PubMed:22051194).

34.757 kDa

MPSANVSPPCPSGVRGGGMGPKAKAEASKPHPQIPVKLPFVTAPDALAAAKARMRDLAAAYVAALPGRDTHSLMAGVPGVDLKFMPLGWRDGAFDPEHNVILINSAARPERQRFTLAHEIGHAILLGDDDLLSDIHDAYEGERLEQVIETLCNVAAAAILMPEPVIAEMLERFGPTGRALAELAKRAEVSASSALYALTEQTPVPVIYAVCAPGKPPREQAASDEDAGPSTEKVLTVRASSSTRGVKYTLASGTPVPADHPAALALATGMEVREESYVPFRSGRKMKAEVDAYPSRGIVAVSFEFDPARLGRKDSEQADRDEPQDAAQ

irrE

Radiation response metalloprotease IrrE

281 amino acids

Plays a central regulatory role in DNA repair and protection pathways in response to radiation stress. Acts as a site-specific metalloprotease that cleaves and inactivates the repressor proteins DdrOC and DdrOP3, resulting in induced expression of genes required for DNA repair and cell survival after exposure to radiation.

30.029 kDa

MTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS

irrE

Radiation response metalloprotease IrrE

281 amino acids

Plays a central regulatory role in DNA repair and protection pathways in response to radiation stress. Acts as a site-specific metalloprotease that cleaves and inactivates the repressor proteins DdrOC and DdrOP3, resulting in induced expression of genes required for DNA repair and cell survival after exposure to radiation.

30.029 kDa

MTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS