IPK

Isopentenyl phosphate kinase

332 amino acids

Catalyzes the formation of isopentenyl diphosphate (IPP), the universal five-carbon isoprenoid building block of all natural isoprenoids (PubMed:24327557, PubMed:26216978). Acts in parallel with the mevalonate (MVA) pathway and plays an important role in regulating the formation of both MVA and methylerythritol phosphate (MEP) pathway-derived terpenoid compounds by controlling the ratio of isopentenyl phosphate (IP) and dimethylallyl phosphate (DMAP) to isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). Controls the levels of IP and DMAP that are competitive inhibitors of the farnesyl diphosphate synthase. Regulates the production of farnesyl diphosphate-derived terpenoids in the cytosol, and geranyl diphosphate-derived compounds in plastids (PubMed:26216978).

Belongs to the isopentenyl phosphate kinase family.

35.676 kDa

MELNISESRSRSIRCIVKLGGAAITCKNELEKIHDENLEVVACQLRQAMLEGSAPSKVIGMDWSKRPGSSEISCDVDDIGDQKSSEFSKFVVVHGAGSFGHFQASRSGVHKGGLEKPIVKAGFVATRISVTNLNLEIVRALAREGIPTIGMSPFSCGWSTSKRDVASADLATVAKTIDSGFVPVLHGDAVLDNILGCTILSGDVIIRHLADHLKPEYVVFLTDVLGVYDRPPSPSEPDAVLLKEIAVGEDGSWKVVNPLLEHTDKKVDYSVAAHDTTGGMETKISEAAMIAKLGVDVYIVKAATTHSQRALNGDLRDSVPEDWLGTIIRFSK

ipk

Putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

282 amino acids

Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol.

Belongs to the GHMP kinase family. IspE subfamily.

30.964 kDa

MEIIEKAPAKINLGLDIAGKYQDGFHELSMIMASVDLNDYLTITEIAEDKIVVESNNCKLPLNRKNDVYKAAHLLKRRYHISTGLKISLQKKIPICAGLGGGSSDAAATLRALNCLWKLNLSPKELIDVGFEIGSDVPYCIEAGCALISGKGEIVEPLATTLSTWVVLVKPDFGISTKTIFKEIDMATISRVDIPALKEALLANYYEDALQFMGNSLEDITIAKKPFIQKIKGRMIKCGADIALMTGSGPTVFALCRTEKRADRVVNSMKGFCKEVYKVRML