inip

SOSS complex subunit C

110 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) (By similarity).

Belongs to the SOSS-C family.

11.972 kDa

MDPGSTASPLQCTAGFPSKNRVAILAELDKEKRKLLLQNQSSTNNPGASIALARPNMNKDFRDHSEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVIPRLEAE

inip

SOSS complex subunit C

107 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) (By similarity).

Belongs to the SOSS-C family.

11.596 kDa

MASPAPGAGFQNKNRVAILAELDKEKRRLIQNSSMNNPGASIPLSRPALNKDFRDHAEQQHIAAQQKAALQHAHAHSSGFFITQDSSFGNLILPVLPRLDPPPPAES

INIP

SOSS complex subunit C

104 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways (By similarity).

Belongs to the SOSS-C family.

11.419 kDa

MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPALNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

INIP

SOSS complex subunit C

104 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.

Belongs to the SOSS-C family.

11.425 kDa

MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

Inip

SOSS complex subunit C

104 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways (By similarity).

Belongs to the SOSS-C family.

11.411 kDa

MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

INIP

SOSS complex subunit C

104 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) (By similarity).

Belongs to the SOSS-C family.

11.437 kDa

MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALTRSPLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLEAE

INIP

SOSS complex subunit C

103 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) (By similarity).

Belongs to the SOSS-C family.

11.292 kDa

MAANPSGQGFQNKNRVAILAELQEKRKLLMQNQSSTNHPGASIALARSPLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLEAE

inip

SOSS complex subunit C

103 amino acids

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) (By similarity).

Belongs to the SOSS-C family.

11.345 kDa

MAANPPGQGFQNKNRVAILAELDKEKRRLIQSQTLNNPGASIPLSRPAVNKEFRDQAEQQHIAAQQKAALQHAHAHSSGFFITQDSSFGNLILPVLPRLDPLE